EMC7/C15orf24 (Human Specific) Monoclonal antibody, PBS Only

• 

  WB analysis using 68722-1-Ig (same clone as 68722-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 68722-1-Ig (C15orf24 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 68722-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 68722-1-Ig (same clone as 68722-1-PBS)

  LNCaP cells were subjected to SDS PAGE followed by western blot with 68722-1-Ig (EMC7/C15orf24 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 68722-1-PBS in a different storage buffer formulation.

• 

  WB analysis of MCF-7 using 68722-1-Ig (same clone as 68722-1-PBS)

  MCF-7 cells were subjected to SDS PAGE followed by western blot with 68722-1-Ig (C15orf24 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 68722-1-PBS in a different storage buffer formulation.

EMC7/C15orf24 (Human Specific) Monoclonal Antibody for WB, Indirect ELISA

Cat No. 68722-1-PBS

Clone No.1D7A6

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

C15orf24, EMC7, 1D7A6, C11orf3, Endoplasmic reticulum membrane protein complex subunit 7

---

Product Information

68722-1-PBS targets EMC7/C15orf24 (Human Specific) in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag26813

  Product name: Recombinant human C15orf24 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 24-159 aa of BC104934

  Sequence: SEVPGAAAEGSGGSGVGIGDRFKIEGRAVVPGVKPQDWISAARVLVDGEEHVGFLKTDGSFVVHDIPSGSYVVEVVSPAYRFDPVRVDITSKGKMRARYVNYIKTSEVVRLPYPLQMKSSGPPSYFIKRESWGWTD

• Full Name: chromosome 15 open reading frame 24
• Observed Molecular Weight: 20-26 kDa
• GenBank Accession Number: BC104934
• Gene Symbol: EMC7
• Gene ID (NCBI): 56851
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q9NPA0
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

The mammalian ER membrane complex (EMC) is composed of 10 subunits, EMC 1-10. Endoplasmic reticulum membrane protein complex subunit 7(EMC7, also named C15orf24) is part of the endoplasmic reticulum membrane protein complex (EMC) that enables theenergy-independent insertion into endoplasmic reticulum membranes of newly synthesized membrane proteins.