ENPP7 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• ENPP7 Polyclonal antibody, PBS Only (32226-1-PBS)

• 

  WB analysis using 32226-1-AP (same clone as 32226-1-PBS)

  Mouse testis tissue lysate was subjected to SDS PAGE followed by western blot with 32226-1-AP (ENPP7 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 32226-1-PBS in a different storage buffer formulation.

ENPP7 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 32226-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, Indirect ELISA

Synonyms

Alkaline sphingomyelin phosphodiesterase, Alk-SMase, EC:3.1.4.12, Ectonucleotide pyrophosphatase/phosphodiesterase family member 7, E-NPP 7

---

Product Information

32226-1-PBS targets ENPP7 in WB, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag36493

  Product name: Recombinant human ENPP7 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 150-400 aa of NM_178543.4

  Sequence: QGVAVTRSRKEGIAHNYKNETEWRANIDTVMAWFTEEDLDLVTLYFGEPDSTGHRYGPESPERREMVRQVDRTVGYLRESIARNHLTDRLNLIITSDHGMTTVDKRAGDLVEFHKFPNFTFRDIEFELLDYGPNGMLLPKEGRLEKVYDALKDAHPKLHVYKKEAFPEAFHYANNPRVTPLLMYSDLGYVIHGRINVQFNNGEHGFDNKDMDMKTIFRAVGPSFRAGLEVEPFESVHVYELMCRLLGIVPE

• Full Name: ectonucleotide pyrophosphatase/phosphodiesterase 7
• Calculated Molecular Weight: 51 kDa，458aa
• Observed Molecular Weight: 51 kDa
• GenBank Accession Number: NM_178543.4
• Gene Symbol: ENPP7
• Gene ID (NCBI): 339221
• RRID: AB_3742548
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q6UWV6
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Ectonucleotide pyrophosphatase/phosphodiesterase family member 7 (ENPP7) stands out as an alkaline sphingomyelinase that functions in the intestine to cleave sphingomyelin (SM) into ceramide and phosphocholine in a phospholipase C (PLC) -like manner and has been associated with hepatobiliary diseases. Reduced ENPP7 activity is detected in colorectal cancer and in familial adenomatous polyposis, suggesting a link between decreased SM metabolism and colon tumorigenesis (PMID: 22177013; 28292932).