Filter: AllWBIF/ICC

WB analysis using 86820-1-RR (same clone as 86820-1-PBS)
Various lysates were subjected to SDS PAGE followed by western blot with 86820-1-RR (ENSA antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 86820-1-PBS in a different storage buffer formulation.
IF Staining of COLO 320 using 86820-1-RR (same clone as 86820-1-PBS)
Immunofluorescent analysis of (4% PFA) fixed COLO 320 cells using ENSA antibody (86820-1-RR, Clone: 251820D6 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 86820-1-PBS in a different storage buffer formulation.

ENSA Recombinant monoclonal antibody, PBS Only

Name: ENSA Recombinant monoclonal antibody, PBS Only
Brand: Proteintech
SKU: 86820-1-PBS

ENSA Uni-rAb^® Recombinant Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 86820-1-PBS

Clone No.251820D6

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

Alpha-endosulfine, ARPP-19e

Formulation: PBS Only

PBS, Azide, Glycerol

PBS Only

Conjugate: Unconjugated

Size/Concentration:

Freight/Packing: -

Quantity

- +

86820-1-PBS targets ENSA in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human samples.

Tested Reactivity	human
Host / Isotype	Rabbit / IgG
Class	Recombinant
Type	Antibody
Immunogen	CatNo: Ag14484 Product name: Recombinant human ENSA protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-121 aa of BC004461 Sequence: MSQKQEEENPAEETGEEKQDTQEKEGILPERAEEAKLKAKYPSLGQKPGGSDFLMKRLQKGQKYFDSGDYNMAKAKMKNKQLPSAGPDKNLVTGDHIPTPQDLPQRKSSLVTSKLAGGQVE Predict reactive species
Full Name	endosulfine alpha
Calculated Molecular Weight	14 kDa
Observed Molecular Weight	15-19 kDa
GenBank Accession Number	BC004461
Gene Symbol	ENSA
Gene ID (NCBI)	2029
RRID	AB_3745142
Conjugate	Unconjugated
Form	Liquid
Purification Method	Protein A purification
UNIPROT ID	O43768
Storage Buffer	PBS only, pH 7.3.
Storage Conditions	Store at -80°C.

Able™