Tested Applications
| Positive WB detected in | SK-BR-3 cells, U2OS cells |
| Positive IF/ICC detected in | COLO 320 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:10000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
86820-1-RR targets ENSA in WB, IF/ICC, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Ag14484 Product name: Recombinant human ENSA protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-121 aa of BC004461 Sequence: MSQKQEEENPAEETGEEKQDTQEKEGILPERAEEAKLKAKYPSLGQKPGGSDFLMKRLQKGQKYFDSGDYNMAKAKMKNKQLPSAGPDKNLVTGDHIPTPQDLPQRKSSLVTSKLAGGQVE Predict reactive species |
| Full Name | endosulfine alpha |
| Calculated Molecular Weight | 14 kDa |
| Observed Molecular Weight | 15-19 kDa |
| GenBank Accession Number | BC004461 |
| Gene Symbol | ENSA |
| Gene ID (NCBI) | 2029 |
| RRID | AB_3745142 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | O43768 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for ENSA antibody 86820-1-RR | Download protocol |
| WB protocol for ENSA antibody 86820-1-RR | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |



