Product Information
26082-1-PBS targets ENT2 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag23310 Product name: Recombinant human SLC29A2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 214-321 aa of BC093634 Sequence: PHLKFARYYLANKSSQAQAQELETKAELLQSDENGIPSSPQKVALTLDLDLEKEPESEPDEPQKPGKPSVFTVFQKIWLTALCLVLVFTVTLSVFPAITAMVTSSTSP Predict reactive species |
| Full Name | solute carrier family 29 (nucleoside transporters), member 2 |
| Observed Molecular Weight | 50 kDa |
| GenBank Accession Number | BC093634 |
| Gene Symbol | SLC29A2 |
| Gene ID (NCBI) | 3177 |
| RRID | AB_3669522 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q14542 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
SLC29A2 also known as ENT2, comprises 456 amino acids and shares 46% amino acid identity with ENT1. ENT2 is involved in the facilitative transport of nucleosides and nucleobases and maintains their cellular homeostasis. The predicted molecular weight of ENT2 is 50 kDa, while 45 kDa band may be observed due to the deglycosylation (PMID: 10722669)

