CoraLite® Plus 488-conjugated EPCR/CD201 Recombinant monoclonal antibody

• 

  IF Staining of bEnd.3 using CL488-84494-2

  Immunofluorescent analysis of (4% PFA) fixed bEnd.3 cells using CoraLite® Plus 488 EPCR/CD201 antibody (CL488-84494-2, Clone: 241853A9 ) at dilution of 1:200.

EPCR/CD201 Uni-rAb^® Recombinant Antibody for IF/ICC

Cat No. CL488-84494-2

Clone No.241853A9

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

IF/ICC

Synonyms

Activated protein C receptor, APC receptor, CD201, Centrocyclin, Centrosomal protein CCD41

---

Tested Applications

• Positive IF/ICC detected in: bEnd.3 cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-84494-2 targets EPCR/CD201 in IF/ICC applications and shows reactivity with mouse samples.

• Tested Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg1517

  Product name: Recombinant Mouse EPCR/CD201 protein (rFc Tag)(HPLC verified)

  Source: mammalian cells-derived, pHZ-KIsec-C-rFc

  Tag: C-rFc

  Domain: 18-214 aa of NM_011171.2

  Sequence: LCNSDGSQSLHMLQISYFQDNHHVRHQGNASLGKLLTHTLEGPSQNVTILQLQPWQDPESWERTESGLQIYLTQFESLVKLVYRERKENVFFPLTVSCSLGCELPEEEEEGSEPHVFFDVAVNGSAFVSFRPKTAVWVSGSQEPSKAANFTLKQLNAYNRTRYELQEFLQDTCVEFLENHITTQNMKGSQTGRSYTS

• Full Name: protein C receptor, endothelial
• Calculated Molecular Weight: 27kDa
• Observed Molecular Weight: 40-50 kDa
• GenBank Accession Number: NM_011171.2
• Gene Symbol: PROCR
• Gene ID (NCBI): 19124
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q64695
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

Protein C receptor (PROCR), also known as activated protein C receptor (APC receptor), EPCR, or CD201, is a transmembrane glycoprotein. EPCR promotes the activation of protein C, which has anticoagulant and cytoprotective effects. EPCR facilitates the activation of protein C by the thrombin-thrombomodulin complex but also facilitates APC-mediated cytoprotective impact on cells that involve the activation of protease-activated receptors (PAR) 1 and 3(PMID: 27207424).