CoraLite® Plus 647 Anti-Mouse EPCR/CD201 Rabbit Recombinant Antibody

• 

  FC experiment of bEnd.3 using CL647-98248

  1x10^6 bEnd.3 cells were surface stained with 0.25 ug CoraLite® Plus 647 Anti-Mouse EPCR/CD201 Rabbit RecAb (CL647-98248, Clone: 241853A7)(red) or 0.25 ug CoraLite® Plus 647 Rabbit IgG Isotype Control RecAb (CL647-98136, Clone: 240953C9) (blue). Cells were not fixed.

EPCR/CD201 Uni-rAb^® Recombinant Antibody for FC

Cat No. CL647-98248

Clone No.241853A7

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

FC

Synonyms

241853A7, Activated protein C receptor, APC receptor, CD201, Centrocyclin

---

Tested Applications

• Positive FC detected in: bEnd.3 cells

Recommended dilution

• Flow Cytometry (FC): FC : 0.25 ug per 10^6 cells in a 100 µl suspension

This reagent has been tested for flow cytometric analysis. It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL647-98248 targets EPCR/CD201 in FC applications and shows reactivity with mouse samples.

• Tested Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg1517

  Product name: Recombinant Mouse EPCR/CD201 protein (rFc Tag)(HPLC verified)

  Source: mammalian cells-derived, pHZ-KIsec-C-rFc

  Tag: C-rFc

  Domain: 18-214 aa of NM_011171.2

  Sequence: LCNSDGSQSLHMLQISYFQDNHHVRHQGNASLGKLLTHTLEGPSQNVTILQLQPWQDPESWERTESGLQIYLTQFESLVKLVYRERKENVFFPLTVSCSLGCELPEEEEEGSEPHVFFDVAVNGSAFVSFRPKTAVWVSGSQEPSKAANFTLKQLNAYNRTRYELQEFLQDTCVEFLENHITTQNMKGSQTGRSYTS

• Full Name: protein C receptor, endothelial
• Calculated Molecular Weight: 27kDa
• GenBank Accession Number: NM_011171.2
• Gene Symbol: PROCR
• Gene ID (NCBI): 19124
• Conjugate: CoraLite® Plus 647 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 654 nm / 674 nm
• Excitation Laser: Red Laser (633 nm)
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q64695
• Storage Buffer: PBS with 0.09% sodium azide, pH 7.3.
• Storage Conditions: Store at 2-8°C. Avoid exposure to light. Stable for one year after shipment.

Background Information

EPCR, also known as CD201, protein C receptor (PROCR), or activated protein C receptor (APC receptor), is a transmembrane glycoprotein. EPCR promotes the activation of protein C, which has anticoagulant and cytoprotective effects. EPCR facilitates the activation of protein C by the thrombin-thrombomodulin complex but also facilitates APC-mediated cytoprotective effects on cells that involve the activation of protease-activated receptors (PAR) 1 and 3(PMID: 27207424).