CoraLite® Plus 488-conjugated EPO/Erythropoietin Monoclonal antibody

EPO/Erythropoietin Monoclonal Antibody for IF/ICC
Cat No. CL488-66975
Clone No.1A11F3

Host / Isotype

Mouse / IgG2a

Reactivity

human, mouse

Applications

IF/ICC

EPO, MVCD2, erythropoietin, Epoetin, EP

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHeLa cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-66975 targets EPO/Erythropoietin in IF/ICC applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Host / Isotype Mouse / IgG2a
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag23054

Product name: Recombinant human EPO protein

Source: e coli.-derived, PET30a

Tag: 6*His

Domain: 29-193 aa of BC093628

Sequence: PPRLICDSRVLERYLLEAKEAENITTGCAEHCSLNENITVPDTKVNFYAWKRMEVGQQAVEVWQGLALLSEAVLRGQALLVNSSQPWEPLQLHVDKAVSGLRSLTTLLRALGAQKEAISPPDAASAAPLRTITADTFRKLFRVYSNFLRGKLKLYTGEACRTGDR

Predict reactive species
Full Name erythropoietin
Calculated Molecular Weight 193 aa, 21 kDa
GenBank Accession NumberBC093628
Gene Symbol EPO/Erythropoietin
Gene ID (NCBI) 2056
RRIDAB_3672931
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP01588
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

Erythropoietin (Epo) is a member of the EPO/TPO family and encodes a secreted, glycosylated cytokine composed of four alpha helical bundles. The protein is found in the plasma and regulates red cell production by promoting erythroid differentiation and initiating hemoglobin synthesis. Its effect is realized by binding erythropoietin receptor (EpoR) expressed on erythroid progenitor cells. EpoR, is a glycoprotein expressed on megakaryocytes, erythroid progenitors and endothelial cells. Epo also has neuroprotective activity against a variety of potential brain injuries and antiapoptotic functions in several tissue types.

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 EPO/Erythropoietin antibody CL488-66975Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...