EPS8 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• EPS8 Polyclonal antibody, PBS Only (12455-1-PBS)

• 

  WB analysis using 12455-1-AP (same clone as 12455-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 12455-1-AP (EPS8 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12455-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 12455-1-AP (same clone as 12455-1-PBS)

  WB result of EPS8 antibody (12455-1-AP; 1:1000; incubated at room temperature for 1.5 hours) with sh-Control and sh-EPS8 transfected HeLa cells. This data was developed using the same antibody clone with 12455-1-PBS in a different storage buffer formulation.

• 

  IP experiment of HeLa using 12455-1-AP (same clone as 12455-1-PBS)

  IP result of anti-EPS8 (IP:12455-1-AP, 3ug; Detection:12455-1-AP 1:500) with HeLa cells lysate 3800ug. This data was developed using the same antibody clone with 12455-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 12455-1-AP (same clone as 12455-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 12455-1-AP (EPS8 antibody) at dilution of 1:100 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 12455-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 12455-1-AP (same clone as 12455-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 12455-1-AP (EPS8 antibody) at dilution of 1:100 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 12455-1-PBS in a different storage buffer formulation.

• 

  IF Staining of A375 using 12455-1-AP (same clone as 12455-1-PBS)

  Immunofluorescent analysis of A375 cells using 12455-1-AP (EPS8 antibody) at dilution of 1:25 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 12455-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

EPS8 Polyclonal Antibody for WB, IHC, IF/ICC, IP, Indirect ELISA

Cat No. 12455-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, IP, Indirect ELISA

Synonyms

Epidermal growth factor receptor kinase substrate 8

---

Product Information

12455-1-PBS targets EPS8 in WB, IHC, IF/ICC, IP, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3121

  Product name: Recombinant human EPS8 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 13-267 aa of BC030010

  Sequence: GMYPSQMNGYGSSPTFSQTDREHGSKTSAKALYEQRKNYARDSVSSVSDISQYRVEHLTTFVLDRKDAMITVDDGIRKLKLLDAKGKVWTQDMILQVDDRAVSLIDLESKNELENFPLNTIQHCQAVMHSCSYDSVLALVCKEPTQNKPDLHLFQCDEVKANLISEDIESAISDSKGGKQKRRPDALRMISNADPSIPPPPRAPAPAPPGTVTQVDVRSRVAAWSAWAADQGDFEKPRQYHEQEETPEMMAARID

• Full Name: epidermal growth factor receptor pathway substrate 8
• Calculated Molecular Weight: 822 aa, 92 kDa
• Observed Molecular Weight: 97 kDa
• GenBank Accession Number: BC030010
• Gene Symbol: EPS8
• Gene ID (NCBI): 2059
• RRID: AB_2098836
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q12929
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Epidermal growth factor receptor Pathway Substrate 8 (EPS8) is a crucial regulator of the actin cytoskeleton dynamics accompanying cell motility and invasion. This protein contains one PH domain and one SH3 domain leading to its binding activity with multiple cellular targets. EPS8 can function as a unique actin capping protein specifically required for dendritic cell migration and plays roles in the regulation of axonal filopodia in neuronal development and synapse formation. The EPS8 gene may contribute to the development of a subset of colorectal cancers and could have applications in diagnosis and treatment.