Home
Products
Primary Antibodies
EPX Polyclonal antibody, PBS Only (29755-1-PBS)

Filter: AllWBIHC

WB analysis using 29755-1-AP (same clone as 29755-1-PBS)
Various lysates were subjected to SDS PAGE followed by western blot with 29755-1-AP (EPX antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 29755-1-PBS in a different storage buffer formulation.
IHC staining of human hepatocirrhosis using 29755-1-AP (same clone as 29755-1-PBS)
Immunohistochemical analysis of paraffin-embedded human hepatocirrhosis tissue slide using 29755-1-AP (EPX antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 29755-1-PBS in a different storage buffer formulation.
IHC staining of human ovary tumor using 29755-1-AP (same clone as 29755-1-PBS)
Immunohistochemical analysis of paraffin-embedded human ovary tumor tissue slide using 29755-1-AP (EPX antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 29755-1-PBS in a different storage buffer formulation.
IHC staining of human ovary tumor using 29755-1-AP (same clone as 29755-1-PBS)
Immunohistochemical analysis of paraffin-embedded human ovary tumor tissue slide using 29755-1-AP (EPX antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 29755-1-PBS in a different storage buffer formulation.
IHC staining of human hepatocirrhosis using 29755-1-AP (same clone as 29755-1-PBS)
Immunohistochemical analysis of paraffin-embedded human hepatocirrhosis tissue slide using 29755-1-AP (EPX antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 29755-1-PBS in a different storage buffer formulation.

EPX Polyclonal antibody, PBS Only

Name: EPX Polyclonal antibody, PBS Only
Brand: Proteintech
SKU: 29755-1-PBS

EPX Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 29755-1-PBS

Review Product

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, pig

Applications

WB, IHC, Indirect ELISA

Synonyms

EPX/ PERE, eosinophil peroxidase

Formulation: PBS Only

PBS, Azide, Glycerol

Conjugate: Unconjugated

Size/Concentration:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Overview

Tested Applications
Product Information

Print datasheet

MSDS SDS

Product Information

29755-1-PBS targets EPX in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, pig samples.

Tested Reactivity	human, mouse, pig
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag30561 Product name: Recombinant human EPX protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 580-673 aa of NM_000502 Sequence: LSQPRNLAQLSRVLKNQDLARKFLNLYGTPDNIDIWIGAIAEPLLPGARVGPLLACLFENQFRRARDGDRFWWQKRGVFTKRQRKALSRISLSR Predict reactive species
Full Name	eosinophil peroxidase
Calculated Molecular Weight	81 kDa
Observed Molecular Weight	55 kDa
GenBank Accession Number	NM_000502
Gene Symbol	EPX
Gene ID (NCBI)	8288
RRID	AB_3086154
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	P11678
Storage Buffer	PBS only, pH 7.3.
Storage Conditions	Store at -80°C.