Eosinophil peroxidase Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• Eosinophil peroxidase Polyclonal antibody, PBS Only (29755-1-PBS)

Eosinophil peroxidase Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 29755-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, pig

Applications

WB, IHC, Indirect ELISA

Synonyms

EPX, EPX/ PERE

• 

  WB analysis using 29755-1-AP (same clone as 29755-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 29755-1-AP (EPX antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 29755-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human hepatocirrhosis using 29755-1-AP (same clone as 29755-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human hepatocirrhosis tissue slide using 29755-1-AP (EPX antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 29755-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human ovary tumor using 29755-1-AP (same clone as 29755-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human ovary tumor tissue slide using 29755-1-AP (EPX antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 29755-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human ovary tumor using 29755-1-AP (same clone as 29755-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human ovary tumor tissue slide using 29755-1-AP (EPX antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 29755-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human hepatocirrhosis using 29755-1-AP (same clone as 29755-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human hepatocirrhosis tissue slide using 29755-1-AP (EPX antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 29755-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Product Information

29755-1-PBS targets Eosinophil peroxidase in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, pig samples.

• Tested Reactivity: human, mouse, pig
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag30561

  Product name: Recombinant human EPX protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 580-673 aa of NM_000502

  Sequence: LSQPRNLAQLSRVLKNQDLARKFLNLYGTPDNIDIWIGAIAEPLLPGARVGPLLACLFENQFRRARDGDRFWWQKRGVFTKRQRKALSRISLSR

• Full Name: eosinophil peroxidase
• Calculated Molecular Weight: 81 kDa
• Observed Molecular Weight: 55 kDa
• GenBank Accession Number: NM_000502
• Gene Symbol: EPX
• Gene ID (NCBI): 8288
• RRID: AB_3086154
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P11678
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

EPX, also known as eosinophil peroxidase, is a cationic heme‑containing peroxidase enzyme that is predominantly stored in the specific granules of eosinophilic granulocytes. Encoded by the EPX gene located on human chromosome 17q13.1, the enzyme is synthesized as a single‑chain precursor that undergoes proteolytic cleavage to form a heavy and a light chain, which remain covalently associated in the mature protein. Upon eosinophil activation by immunological or inflammatory stimuli, EPX is secreted into the extracellular milieu where it catalyzes the hydrogen peroxide‑dependent oxidation of halides (bromide, chloride) and thiocyanate to generate potent cytotoxic oxidants, such as hypobromous acid and hypothiocyanous acid. These reactive species are essential for the eosinophil's effector function against helminthic parasites and certain bacteria, but they also exert profound pro‑inflammatory and tissue‑damaging effects when released inappropriately. Indeed, elevated EPX levels and activity have been implicated in the pathogenesis of allergic asthma, atopic dermatitis, and other eosinophilic disorders, making the enzyme not only a useful diagnostic biomarker but also an emerging therapeutic target for modulating eosinophil‑driven inflammation.