ERMAP Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• ERMAP Polyclonal antibody, PBS Only (21375-1-PBS)

• 

  IP experiment of MCF-7 using 21375-1-AP (same clone as 21375-1-PBS)

  IP result of anti-ERMAP (IP:21375-1-AP, 4ug; Detection:21375-1-AP 1:300) with MCF-7 cells lysate 1600ug. This data was developed using the same antibody clone with 21375-1-PBS in a different storage buffer formulation.

• 

  IF Staining of MCF-7 using 21375-1-AP (same clone as 21375-1-PBS)

  Immunofluorescent analysis of (-20℃ Ethanol) fixed MCF-7 cells using 21375-1-AP (ERMAP antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 21375-1-PBS in a different storage buffer formulation.

ERMAP Polyclonal Antibody for IF/ICC, IP, Indirect ELISA

Cat No. 21375-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IF/ICC, IP, Indirect ELISA

Synonyms

---

Product Information

21375-1-PBS targets ERMAP in IF/ICC, IP, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag15899

  Product name: Recombinant human ERMAP protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 176-475 aa of BC099703

  Sequence: IWKQRRAKEKLLYEHVTEVDNLLSDHAKEKGKLHKAVKKLRSELKLKRAAANSGWRRARLHFVAVTLDPDTAHPKLILSEDQRCVRLGDRRQPVPDNPQRFDFVVSILGSEYFTTGCHYWEVYVGDKTKWILGVCSESVSRKGKVTASPANGHWLLRQSRGNEYEALTSPQTSFRLKEPPRCVGIFLDYEAGVISFYNVTNKSHIFTFTHNFSGPLRPFFEPCLHDGGKNTAPLVICSELHKSEESIVPRPEGKGHANGDVSLKVNSSLLPPKAPELKDIILSLPPDLGPALQELKAPSF

• Full Name: erythroblast membrane-associated protein (Scianna blood group)
• Calculated Molecular Weight: 475 aa, 53 kDa
• Observed Molecular Weight: 53 kDa
• GenBank Accession Number: BC099703
• Gene Symbol: ERMAP
• Gene ID (NCBI): 114625
• RRID: AB_2878849
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96PL5
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.