ERVWE1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• ERVWE1 Polyclonal antibody, PBS Only (23172-1-PBS)

• 

  WB analysis using 23172-1-AP (same clone as 23172-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 23172-1-AP (ERVWE1 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 23172-1-PBS in a different storage buffer formulation.

ERVWE1 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 23172-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

---

Product Information

23172-1-PBS targets ERVWE1 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag19227

  Product name: Recombinant human ERVWE1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 274-371 aa of BC137381

  Sequence: TSAYRCLNGSSESMCFLSFLVPPMTIYTEQDLYSYVISKPRNKRVPILPFVIGAGVLGALGTGIGGITTSTQFYYKLSQELNGDMERVADSLVTLQDQ

• Full Name: endogenous retroviral family W, env(C7), member 1
• Calculated Molecular Weight: 538 aa, 60 kDa
• Observed Molecular Weight: 70-73 kDa
• GenBank Accession Number: BC137381
• Gene Symbol: ERVWE1
• Gene ID (NCBI): 30816
• RRID: AB_3085707
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9UQF0
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

ERVWE1 encodes a 538 amino-acid, 73-kDa glycosylated (60 kDa unglycosylated) envelope protein, Syncytin-1. It is expressed in the placental syncytiotrophoblast and participates in syncytium formation during placenta morphogenesis. Mounting evidence suggests that aberrant expression of ERVWE1 involves the etiology of schizophrenia.