• Featured Product
  • KD/KO Validated

CoraLite® Plus 488-conjugated ESR2 Monoclonal antibody

ESR2 Monoclonal Antibody for WB, FC (Intra)
Cat No. CL488-60197
Clone No.5D2C9

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse

Applications

WB, FC (Intra)

ESTRB, ERβ, ER-beta, Erb, ER BETA

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inMCF-7 cells, SW 1990 cells
Positive FC (Intra) detected inMCF-7 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:1000
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-60197 targets ESR2 in WB, FC (Intra) applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag5103

Product name: Recombinant human ESR2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-323 aa of BC024181

Sequence: MDIKNSPSSLNSPSSYNCSQSILPLEHGSIYIPSSYVDSHHEYPAMTFYSPAVMNYSIPSNVTNLEGGPGRQTTSPNVLWPTPGHLSPLVVHRQLSHLYAEPQKSPWCEARSLEHTLPVNRETLKRKVSGNRCASPVTGPGSKRDAHFCAVCSDYASGYHYGVWSCEGCKAFFKRSIQGHNDYICPATNQCTIDKNRRKSCQACRLRKCYEVGMVKCGSRRERCGYRLVRRQRSADEQLHCAGKAKRSGGHAPRVRELLLDALSPEQLVLTLLEAEPPHVLISRPSAPFTEASMMMSLTKLADKELVHMISWAKKIPGMRGNA

Predict reactive species
Full Name estrogen receptor 2 (ER beta)
Calculated Molecular Weight 59 kDa
Observed Molecular Weight 50 kDa
GenBank Accession NumberBC024181
Gene Symbol ESR2
Gene ID (NCBI) 2100
RRIDAB_3084142
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
Excitation LaserBlue laser (488 nm)
FormLiquid
Purification MethodProtein G purification
UNIPROT IDQ92731
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

Estrogen receptor-beta (ESR2) is a member of the superfamily of nuclear receptors, which can transduce extracellular signals into transcriptional responses. It binds estrogens with an affinity similar to that of ESR1, and activates expression of reporter genes containing estrogen response elements (ERE) in an estrogen-dependent manner. DNA-binding by ESR1 and ESR2 is rapidly lost at 37 degrees Celsius in the absence of ligand while in the presence of 17 beta-estradiol and 4-hydroxy-tamoxifen loss in DNA-binding at elevated temperature is more gradual. ESR2 exists various isoform and range of calculated molecular weight of isoforms is 50-60 kDa. The experiment detected two bands for ESR2 in isolated human germ cells, one at 60 kDa and a weaker one at 50 kDa (PMID: 14766008).

Protocols

Product Specific Protocols
FC protocol for CL Plus 488 ESR2 antibody CL488-60197Download protocol
WB protocol for CL Plus 488 ESR2 antibody CL488-60197Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...