ESRRB Monoclonal antibody

ESRRB Monoclonal Antibody for WB, IHC, IF/ICC, ELISA
Cat No. 66818-1-Ig
Clone No.3E10C1

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

3E10C1, ERR beta-2, ERRb, ERRB2, ERRbeta

Formulation:  PBS and Azide
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHEK-293 cells, HeLa cells, NCCIT cells, JAR cells, A549 cells, Caco-2 cells, LNCaP cells, HT-29 cells, Rat brain tissue, Mouse brain tissue
Positive IHC detected inhuman prostate cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inCaco-2 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:4000
Immunohistochemistry (IHC)IHC : 1:1000-1:4000
Immunofluorescence (IF)/ICCIF/ICC : 1:400-1:1600
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Published Applications

IFSee 1 publications below

Product Information

66818-1-Ig targets ESRRB in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag18626

Product name: Recombinant human ESRRB protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-91 aa of BC131517

Sequence: MSSDDRHLGSSCGSFIKTEPSSPSSGIDALSHHSPSGSSDASGGFGLALGTHANGLDSPPMFAGAGLGGTPCRKSYEDCASGIMEDSAIKC

Predict reactive species
Full Name estrogen-related receptor beta
Calculated Molecular Weight 508 aa, 56 kDa
Observed Molecular Weight 47 kDa
GenBank Accession NumberBC131517
Gene Symbol ESRRB
Gene ID (NCBI) 2103
RRIDAB_2882161
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDO95718
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Estrogen related receptor beta (ESRRB), a NR3 Steroid Receptor, has been shown to affect early placental development. Also it can act as a repressor of transcriptional activity mediated by the glucocorticoid receptor (GR). It binds as a monomer to the extended half-site TNAAGTGCA and as a homodimer to the estrogen response element (ERE), palindromic thyroid hormone response element (TRE(pal)), and SF-1 response element, but not to the glucocorticoid response element (GRE). Estrogen related receptor beta mutations lead to abnormal development of the chorion and defective diploid trophoblast proliferation, and are lethal during midgestation. Expression has been documented in mice in the extra embryonic ectoderm that gives rise to the chorion. ESTs have been isolated from normal human eye, lung, and testis libraries. The ligand for the receptor is PPARgamma coactivator 1 (PGC-1) beta. ESRRB exists various isoforms and molecular weight of each isoform is 48 kDa,55 kDa and 56 kDa.

Protocols

Product Specific Protocols
WB protocol for ESRRB antibody 66818-1-IgDownload protocol
IHC protocol for ESRRB antibody 66818-1-IgDownload protocol
IF protocol for ESRRB antibody 66818-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanIF

Stem Cell Res

Establishment of a CRISPR/Cas9-mediated GATAD2B homozygous knockout human embryonic stem cell line

Authors - Bo Wang
Loading...
||
New chat Able
正在加载,请稍候...