• Featured Product
  • KD/KO Validated

CoraLite® Plus 488-conjugated EYA1 Polyclonal antibody

EYA1 Polyclonal Antibody for IF/ICC, FC (Intra)
Cat No. CL488-22658

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IF/ICC, FC (Intra)

EC:3.1.3.16, BOR, BOP

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHeLa cells
Positive FC (Intra) detected inHeLa cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.80 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-22658 targets EYA1 in IF/ICC, FC (Intra) applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag18489

Product name: Recombinant human EYA1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-300 aa of BC121799

Sequence: MEMQDLTSPHSRLSGSSESPSGPKLGNSHINSNSMTPNGTEVKTEPMSSSETASTTADGSLNNFSGSAIGSSSFSPRPTHQFSPPQIYPSNRPYPHILPTPSSQTMAAYGQTQFTTGMQQATAYATYPQPGQPYGISSYGALWAGIKTEGGLSQSQSPGQTGFLSYGTSFSTPQPGQAPYSYQMQGSSFTTSSGIYTGNNSLTNSSGFNSSQQDYPSYPSFGQGQYAQYYNSSPYPAHYMTSSNTSPTTPSTNATYQLQEPPSGITSQAVTDPTAEYSTIHSPSTPIKDSDSDRLRRGSD

Predict reactive species
Full Name eyes absent homolog 1 (Drosophila)
Calculated Molecular Weight 592 aa, 65 kDa
Observed Molecular Weight 60 kDa, 50 kDa
GenBank Accession NumberBC121799
Gene Symbol EYA1
Gene ID (NCBI) 2138
RRIDAB_3672747
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ99502
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

The EYA1 (Eyes absent homolog 1) gene is the human homologue of the Drosophila Eya1 gene, which is essential for eye development in that species. There are 4 different isoforms of EYA1 (EYA1A, EYA1B, EYA1C, EYA1D), which are composed of 559 amino acids (AA), 592 AA, 592 AA and 557 AA, respectively. It should be noted that isoforms B and C have the same length; however, they could be considered different variants because of change in amino acidic composition (PMID: 24803398).

Protocols

Product Specific Protocols
FC protocol for CL Plus 488 EYA1 antibody CL488-22658Download protocol
IF protocol for CL Plus 488 EYA1 antibody CL488-22658Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...