EYA3 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• EYA3 Polyclonal antibody, PBS Only (21196-1-PBS)

• 

  WB analysis of HeLa using 21196-1-AP (same clone as 21196-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 21196-1-AP (EYA3 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 21196-1-PBS in a different storage buffer formulation.

• 

  WB analysis of L02 using 21196-1-AP (same clone as 21196-1-PBS)

  L02 cells were subjected to SDS PAGE followed by western blot with 21196-1-AP (EYA3 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 21196-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 21196-1-AP (same clone as 21196-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 21196-1-AP (EYA3 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 21196-1-PBS in a different storage buffer formulation.

• 

  WB analysis of L02 using 21196-1-AP (same clone as 21196-1-PBS)

  L02 cells were subjected to SDS PAGE followed by western blot with 21196-1-AP (EYA3 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 21196-1-PBS in a different storage buffer formulation.

• 

  IP experiment of L02 using 21196-1-AP (same clone as 21196-1-PBS)

  IP result of anti-EYA3 (IP:21196-1-AP, 4ug; Detection:21196-1-AP 1:1000) with L02 cells lysate 1800ug. This data was developed using the same antibody clone with 21196-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 21196-1-AP (same clone as 21196-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 21196-1-AP (EYA3 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 21196-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 21196-1-AP (same clone as 21196-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 21196-1-AP (EYA3 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 21196-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 21196-1-AP (same clone as 21196-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 21196-1-AP (EYA3 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 21196-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 21196-1-AP (same clone as 21196-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 21196-1-AP (EYA3 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 21196-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 21196-1-AP (same clone as 21196-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using EYA3 antibody (21196-1-AP) at dilution of 1:1000 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 21196-1-PBS in a different storage buffer formulation.

• 

  FC experiment of A431 using 21196-1-AP (same clone as 21196-1-PBS)

  1x10^6 A431 cells were intracellularly stained with 0.25 ug EYA3 Polyclonal antibody (21196-1-AP) and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2)(red), or 0.25 ug Rabbit IgG control Rabbit PolyAb (30000-0-AP) (blue). Cells were fixed and permeabilized with Transcription Factor Staining Buffer Kit (PF00011). This data was developed using the same antibody clone with 21196-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

EYA3 Polyclonal Antibody for WB, IHC, IF/ICC, IP, Indirect ELISA

Cat No. 21196-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, IP, Indirect ELISA

Synonyms

EC:3.1.3.48

---

Product Information

21196-1-PBS targets EYA3 in WB, IHC, IF/ICC, IP, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag15544

  Product name: Recombinant human EYA3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-300 aa of BC029500

  Sequence: MEEEQDLPEQPVKKAKMQESGEQTISQVSNPDVSDQKPETSSLASNLPMSEEIMTCTDYIPRSSNDYTSQMYSAKPYAHILSVPVSETAYPGQTQYQTLQQTQPYAVYPQATQTYGLPPFGALWPGMKPESGLIQTPSPSQHSVLTCTTGLTTSQPSPAHYSYPIQASSTNASLISTSSTIANIPAAAVASISNQDYPTYTILGQNQYQACYPSSSFGVTGQTNSDAESTTLAATTYQSEKPSVMAPAPAAQRLSSGDPSTSPSLSQTTPSKDTDDQSRKNMTSKNRGKRKADATSSQDS

• Full Name: eyes absent homolog 3 (Drosophila)
• Calculated Molecular Weight: 573 aa, 63 kDa
• Observed Molecular Weight: 63-66 kDa
• GenBank Accession Number: BC029500
• Gene Symbol: EYA3
• Gene ID (NCBI): 2140
• RRID: AB_10732957
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q99504
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

EYA3(Eyes absent homolog 3) belongs to the HAD-like hydrolase superfamily.Its function as histone phosphatase probably explains its role in transcription regulation during organogenesis.EYA3, like EYA1, is expressed in the ninth week of human development and may also underlie developmental defects(PMID:9020840).It has 2 isoforms produced by alternative splicing.This antibody is specific to EYA3.