Ephrin B1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• Ephrin B1 Polyclonal antibody, PBS Only (12999-1-PBS)

• 

  WB analysis using 12999-1-AP (same clone as 12999-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 12999-1-AP (Ephrin B1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12999-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human kidney using 12999-1-AP (same clone as 12999-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 12999-1-AP (Ephrin B1 antibody) at dilution of 1:2000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 12999-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human kidney using 12999-1-AP (same clone as 12999-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 12999-1-AP (Ephrin B1 antibody) at dilution of 1:2000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 12999-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse kidney using 12999-1-AP (same clone as 12999-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 12999-1-AP (Ephrin B1 antibody) at dilution of 1:2000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 12999-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse kidney using 12999-1-AP (same clone as 12999-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 12999-1-AP (Ephrin B1 antibody) at dilution of 1:2000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 12999-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

Ephrin B1 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 12999-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

EFL3, EFNB1, EPLG2, LERK2, EFL-3

---

Product Information

12999-1-PBS targets Ephrin B1 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3669

  Product name: Recombinant human EFNB1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 32-239 aa of BC016649

  Sequence: LEPVSWSSLNPKFLSGKGLVIYPKIGDKLDIICPRAEAGRPYEYYKLYLVRPEQAAACSTVLDPNVLVTCNRPEQEIRFTIKFQEFSPNYMGLEFKKHHDYYITSTSNGSLEGLENREGGVCRTRTMKIIMKVGQDPNAVTPEQLTTSRPSKEADNTVKMATQAPGSRGSLGDSDGKHETVNQEEKSGPGASGGSSGDPDGFFNSKVA

• Full Name: ephrin-B1
• Calculated Molecular Weight: 346 aa, 38 kDa
• Observed Molecular Weight: 38 kDa
• GenBank Accession Number: BC016649
• Gene Symbol: Ephrin B1
• Gene ID (NCBI): 1947
• RRID: AB_10644156
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P98172
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

EFNB1 (Ephrin B1) is a member of the ephrin family, which are membrane-bound guidance cues that interact with Eph receptors, a family of receptor tyrosine kinases. EFNB1 is X-inactivated, and it has been proposed that in heterozygous females, patchy loss of ephrin B1 disturbs tissue boundary formation at the developing coronal suture (PMID: 34824583, 18627045). EFNB1 mainly plays a central part in cell adhesion, angiogenesis, and development of the nervous system (PMID: 30326247).