• Featured Product
  • KD/KO Validated

Ezrin Polyclonal antibody

Ezrin Polyclonal Antibody for WB, IHC, IF/ICC, IF-P, FC (Intra), IP, ELISA
Cat No. 26056-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (1)

Applications

WB, IHC, IF/ICC, IF-P, FC (Intra), IP, RIP, ELISA

EZR, VIL2, Villin-2

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHeLa cells, NIH/3T3 cells, mouse kidney tissue, rat kidney tissue
Positive IP detected inHeLa cells
Positive IHC detected inmouse stomach tissue, human small intestine tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-P detected inrat eye tissue, mouse eye tissue
Positive IF/ICC detected inHeLa cells
Positive FC (Intra) detected inHeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:20000-1:100000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:500-1:2000
Immunofluorescence (IF)-PIF-P : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:400-1:1600
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

26056-1-AP targets Ezrin in WB, IHC, IF/ICC, IF-P, FC (Intra), IP, RIP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, pig
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag23530

Product name: Recombinant human Ezrin protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 477-529 aa of BC013903

Sequence: VYEPVSYHVQESLQDEGAEPTGYSAELSSEGIRDDRNEEKRITEAEKNERVQR

Predict reactive species
Full Name ezrin
Calculated Molecular Weight 69 kDa
Observed Molecular Weight 70-80 kDa
GenBank Accession NumberBC013903
Gene Symbol Ezrin
Gene ID (NCBI) 7430
ENSEMBL Gene IDENSG00000092820
RRIDAB_2722561
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP15311
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Ezrin is a member of the ERM (Ezrin, Radixin, Moesin) protein family and serves as a crucial linker between the cell membrane and the actin cytoskeleton. It plays significant roles in various cellular processes, including maintaining cell morphology, facilitating cell movement and adhesion, regulating signal transduction, and influencing apoptosis.

Protocols

Product Specific Protocols
IF protocol for Ezrin antibody 26056-1-APDownload protocol
IHC protocol for Ezrin antibody 26056-1-APDownload protocol
IP protocol for Ezrin antibody 26056-1-APDownload protocol
WB protocol for Ezrin antibody 26056-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
mouse,humanIF

Acta Neuropathol

Selective vulnerability of tripartite synapses in amyotrophic lateral sclerosis.

Authors - Matthew J Broadhead
humanWB

Proc Natl Acad Sci U S A

Cotranslational interaction of human EBP50 and ezrin overcomes masked binding site during complex assembly.

Authors - Krishnendu Khan
  • KO Validated
mouseWB

Elife

Gq activity- and β-arrestin-1 scaffolding-mediated ADGRG2/CFTR coupling are required for male fertility.

Authors - Dao-Lai Zhang
humanWB

Int J Mol Sci

Bidirectional Tumor-Promoting Activities of Macrophage Ezrin.

Authors - Krishnendu Khan
  • KD Validated
mouseWB

J Biol Chem

Ciliary neurotrophic factor (CNTF) protects retinal cone and rod photoreceptors by suppressing excessive formation of the visual pigments.

Authors - Songhua Li
pigWB,IF

J Virol

Pemetrexed alleviates piglet diarrhea by blocking the interaction between porcine epidemic diarrhea virus nucleocapsid protein and Ezrin

Authors - Shujuan Zhang
Loading...
||
New chat Able
正在加载,请稍候...