FA2H Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 86020-2-RR (same clone as 86020-2-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 86020-2-RR (FA2H antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 86020-2-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 86020-2-RR

  Biolayer interferometry (BLl) kinetic assays of 86020-2-RR against Human FA2H were performed. The affinity constant is 0.127 nM.

FA2H Uni-rAb^® Recombinant Antibody for WB, Indirect ELISA

Cat No. 86020-2-PBS

Clone No.250401F2

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

EC:1.14.18.-, FAAH, Fatty acid 2-hydroxylase, Fatty acid alpha-hydroxylase, Fatty acid hydroxylase domain-containing protein 1

---

Product Information

86020-2-PBS targets FA2H in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag7717

  Product name: Recombinant human FA2H protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-164 aa of BC002679

  Sequence: MAPAPPPAASFSPSEVQRRLAAGACWVRRGARLYDLSSFVRHHPGGEQLLRARAGQDISADLDGPPHRHSANARRWLEQYYVGELRGEQQGSMENEPVALEETQKTDPAMEPRFKVVDWDKDLVDWRKPLLWQVGHLGEKYDEWVHQPVTRPIRLFHSDLIEGL

• Full Name: fatty acid 2-hydroxylase
• Calculated Molecular Weight: 43 kDa
• Observed Molecular Weight: 43 kDa
• GenBank Accession Number: BC002679
• Gene Symbol: FA2H
• Gene ID (NCBI): 79152
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q7L5A8
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

FA2H(Fatty acid 2-hydroxylase) required for alpha-hydroxylation of free fatty acids and the formation of alpha-hydroxylated sphingolipids. The deduced 372-amino acid protein has a calculated molecular mass of 42.8 kD .Both mouse and human FA2H have a C-terminal endoplasmic reticulum (ER) retention motif(PMID: 15658937).