Product Information
21768-1-PBS targets FAM117B in WB, IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag16407 Product name: Recombinant human FAM117B protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 49-128 aa of BC106906 Sequence: SKHSSRHHRDKERQSPFHGNHAAINQCQAPVPKSALIPVIPITKSTGSRFRNSVEGLNQEIEIIIKETGEKEEQLIPQDI Predict reactive species |
| Full Name | family with sequence similarity 117, member B |
| Calculated Molecular Weight | 589 aa, 62 kDa |
| Observed Molecular Weight | 66 kDa |
| GenBank Accession Number | BC106906 |
| Gene Symbol | FAM117B |
| Gene ID (NCBI) | 150864 |
| RRID | AB_10804757 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q6P1L5 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
FAM117B, also named as ALS2CR13, is mapped in the genomic region covering the complete candidate region for Amyotrophic lateral sclerosis 2 (ALS2). This antibody is specific to FAM117B.



