FAM117B Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• FAM117B Polyclonal antibody, PBS Only (21768-1-PBS)

• 

  WB analysis using 21768-1-AP (same clone as 21768-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 21768-1-AP (FAM117B antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 21768-1-PBS in a different storage buffer formulation.

• 

  IP experiment of HEK-293 using 21768-1-AP (same clone as 21768-1-PBS)

  IP result of anti-FAM117B (IP:21768-1-AP, 4ug; Detection:21768-1-AP 1:500) with HEK-293 cells lysate 920ug. This data was developed using the same antibody clone with 21768-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

FAM117B Polyclonal Antibody for WB, IP, Indirect ELISA

Cat No. 21768-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IP, Indirect ELISA

Synonyms

---

Product Information

21768-1-PBS targets FAM117B in WB, IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag16407

  Product name: Recombinant human FAM117B protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 49-128 aa of BC106906

  Sequence: SKHSSRHHRDKERQSPFHGNHAAINQCQAPVPKSALIPVIPITKSTGSRFRNSVEGLNQEIEIIIKETGEKEEQLIPQDI

• Full Name: family with sequence similarity 117, member B
• Calculated Molecular Weight: 589 aa, 62 kDa
• Observed Molecular Weight: 66 kDa
• GenBank Accession Number: BC106906
• Gene Symbol: FAM117B
• Gene ID (NCBI): 150864
• RRID: AB_10804757
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q6P1L5
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

FAM117B, also named as ALS2CR13, is mapped in the genomic region covering the complete candidate region for Amyotrophic lateral sclerosis 2 (ALS2). This antibody is specific to FAM117B.