CoraLite® Plus 488-conjugated FAM136A Recombinant monoclonal antibody

• 

  IF Staining of HeLa using CL488-84150-2

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using CoraLite® Plus 488 FAM136A antibody (CL488-84150-2, Clone: 241433D12 ) at dilution of 1:200, CL594-Phalloidin (red).

FAM136A Recombinant Antibody for IF/ICC

Cat No. CL488-84150-2

Clone No.241433D12

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IF/ICC

Synonyms

Protein FAM136A, 241433D12

---

Tested Applications

• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-84150-2 targets FAM136A in IF/ICC applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag34058

  Product name: Recombinant human FAM136A protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-138 aa of BC014975

  Sequence: MAELQQLRVQEAVESMVKSLERENIRKMQGLMFRCSASCCEDSQASMKQVHQCIERCHVPLAQAQALVTSELEKFQDRLARCTMHCNDKAKDSIDAGSKELQVKQQLDSCVTKCVDDHMHLIPTMTKKMKEALLSIGK

• Full Name: family with sequence similarity 136, member A
• Observed Molecular Weight: 12 kDa
• GenBank Accession Number: BC014975
• Gene Symbol: FAM136A
• Gene ID (NCBI): 84908
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q96C01
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

FAM136A is an evolutively conserved nuclear gene encoding a mitochondrial protein whose specific function is unknown, but which is commonly found in neurosensory epithelial cells, where it plays a role in the electron transport chain of respiration (PMID: 37461313). FAM136A, with a molecular mass of 16-kDa, is normally expressed in the cytoplasm and has been linked to familial Meniere's disease.