FAM57B Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• FAM57B Polyclonal antibody, PBS Only (20760-1-PBS)

• 

  WB analysis using 20760-1-AP (same clone as 20760-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 20760-1-AP (FAM57B antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 20760-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 20760-1-AP (same clone as 20760-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 20760-1-AP (FAM57B antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 20760-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse brain using 20760-1-AP (same clone as 20760-1-PBS)

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 20760-1-AP (FAM57B antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 20760-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse colon using 20760-1-AP (same clone as 20760-1-PBS)

  mouse colon tissue were subjected to SDS PAGE followed by western blot with 20760-1-AP (FAM57B antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 20760-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 20760-1-AP (same clone as 20760-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 20760-1-AP (FAM57B antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 20760-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 20760-1-AP (same clone as 20760-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 20760-1-AP (FAM57B antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 20760-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

FAM57B Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 20760-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

---

Product Information

20760-1-PBS targets FAM57B in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag14707

  Product name: Recombinant human FAM57B protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 46-140 aa of BC007892

  Sequence: SVQAIMASTAGYIVSTSCKHIIDDQHWLSSAYTQFAVPYFIYDIYAMFLCHWHKHQVKGHGGDDGAARAPGSTWAIARGYLHKEFLMVLHHAAMV

• Full Name: family with sequence similarity 57, member B
• Calculated Molecular Weight: 274 aa, 31 kDa
• Observed Molecular Weight: 31 kDa
• GenBank Accession Number: BC007892
• Gene Symbol: FAM57B
• Gene ID (NCBI): 83723
• RRID: AB_10732598
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q71RH2
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.