• Featured Product
  • KD/KO Validated

CoraLite® Plus 488-conjugated FATP2 Polyclonal antibody

FATP2 Polyclonal Antibody for IF/ICC
Cat No. CL488-14048

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IF/ICC

ACSVL1, FACVL1, FATP 2, FATP2, Fatty acid transport protein 2, hFACVL1, HsT17226, SLC27A2, THCA CoA ligase, VLACS, VLCS

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHepG2 cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-14048 targets FATP2 in IF/ICC applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag5217

Product name: Recombinant human SLC27A2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 208-567 aa of BC057770

Sequence: ESWRSEVTFSTPALYIYTSGTTGATLALRTKFSASQFWDDCRKYNVTVIQYIGELLRYLCNSPQKPNDRDHKVRLALGNGLRGDVWRQFVKRFGDICIYEFYAATEGNIGFMNYARKVGAVGRVNYLQKKIITYDLIKYDVEKDEPVRDENGYCVRVPKGEVGLLVCKITQLTPFNGYAGAKAQTEKKKLRDVFKKGDLYFNSGDLLMVDHENFIYFHDRVGDTFRWKGENVATTEVADTVGLVDFVQEVNVYGVHVPDHEGRIGMASIKMKENHEFDGKKLFQHIADYLPSYARPRFLRIQDTIEITGTFKHRKMTLVEEGFNPAVIKDALYFLDDTAKMYVPMTEDIYNAISAKTLKL

Predict reactive species
Full Name solute carrier family 27 (fatty acid transporter), member 2
Calculated Molecular Weight 567 aa, 65 kDa
Observed Molecular Weight 70 kDa
GenBank Accession NumberBC057770
Gene Symbol FATP2/SLC27A2
Gene ID (NCBI) 11001
RRIDAB_3083950
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDO14975
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

FATP2 is a member of the FATP family which functions in lipid and bile metabolism. It is a 70-kDa protein predominantly expressed in liver and kidney. Kidney FATP2 is localized exclusively to proximal tubule epithelial cells along the apical but not the basolateral membrane, and regulates lipoapoptosis. FATP2 is involved in metabolism-related diseases including nonalcoholic fatty liver disease (NAFLD) and type 2 diabetes mellitus (T2DM), and is a potential clinical biomarker and therapeutic target.

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 FATP2 antibody CL488-14048Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...