FBXO32 Monoclonal antibody

• Home
• Products
• Primary Antibodies
• FBXO32 Monoclonal antibody (67172-1-Ig)

FBXO32 Monoclonal Antibody for WB, IHC, IF-P, ELISA

Cat No. 67172-1-Ig Copied!

Clone No. 3C2G3

Publications (79)

Download datasheet

Host / Isotype

Mouse / IgG2b

Reactivity

human, mouse, rat, pig and More (1)

Applications

WB, IHC, IF-P, IP, CoIP, ELISA

Synonyms

3C2G3, Atrogin 1, Atrogin-1, F box only protein 32, F box protein 32

• 

  WB analysis using 67172-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 67172-1-Ig (FBXO32 antibody) at dilution of 1:15000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of human heart using 67172-1-Ig

  human heart tissue were subjected to SDS PAGE followed by western blot with 67172-1-Ig (FBXO32 antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of pig heart using 67172-1-Ig

  pig heart tissue were subjected to SDS PAGE followed by western blot with 67172-1-Ig (FBXO32 antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of pig skeletal muscle using 67172-1-Ig

  pig skeletal muscle tissue were subjected to SDS PAGE followed by western blot with 67172-1-Ig (FBXO32 antibody) at dilution of 1:15000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse skeletal muscle using 67172-1-Ig

  Immunohistochemical analysis of paraffin-embedded mouse skeletal muscle tissue slide using 67172-1-Ig (FBXO32 antibody) at dilution of 1:4000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse skeletal muscle using 67172-1-Ig

  Immunohistochemical analysis of paraffin-embedded mouse skeletal muscle tissue slide using 67172-1-Ig (FBXO32 antibody) at dilution of 1:4000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of rat skeletal muscle using 67172-1-Ig

  Immunohistochemical analysis of paraffin-embedded rat skeletal muscle tissue slide using 67172-1-Ig (FBXO32 antibody) at dilution of 1:4000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of rat skeletal muscle using 67172-1-Ig

  Immunohistochemical analysis of paraffin-embedded rat skeletal muscle tissue slide using 67172-1-Ig (FBXO32 antibody) at dilution of 1:4000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of mouse skeletal muscle using 67172-1-Ig

  Immunofluorescent analysis of (4% PFA) fixed mouse skeletal muscle tissue using FBXO32 antibody (67172-1-Ig, Clone: 3C2G3 ) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of mouse skeletal muscle using 67172-1-Ig

  Immunofluorescent analysis of (4% PFA) fixed mouse skeletal muscle tissue using FBXO32 antibody (67172-1-Ig, Clone: 3C2G3 ) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for FBXO32 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: mouse skeletal muscle tissue, human heart tissue, pig heart tissue, pig skeletal muscle tissue, Rabbit skeletal muscle tissue
• Positive IHC detected in: mouse skeletal muscle tissue, rat skeletal muscle tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF-P detected in: mouse skeletal muscle tissue

Recommended dilution

• Western Blot (WB): WB : 1:15000-1:50000
• Immunohistochemistry (IHC): IHC : 1:2000-1:8000
• Immunofluorescence (IF)-P: IF-P : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

67172-1-Ig targets FBXO32 in WB, IHC, IF-P, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat, pig samples.

• Tested Reactivity: human, mouse, rat, pig
• Cited Reactivity: human, mouse, rat, pig, canine
• Host / Isotype: Mouse / IgG2b
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag25247

  Product name: Recombinant human FBXO32 protein

  Source: e coli.-derived, PET30a

  Tag: 6*His

  Domain: 1-216 aa of BC024030

  Sequence: IAQKNFMNILEKVVLKVLEDQQNIRLIRELLQTLYTSLCTLVQRVGKSVLVGNINMWVYRMETILHWQQQLNNIQITRPAFKGLTFTDLPLCLQLNIMQRLSDGRDLVSLGQAAPDLHVLSEDRLLWKKLCQYHFSERQIRKRLILSDKGQLDWKKMYFKLVRCYPRKEQYGDTLQLRKHCHILSWKGTDHPCTANNPESCSVSLSPQDFINLFKF

• Full Name: F-box protein 32
• Calculated Molecular Weight: 355 aa, 42 kDa
• Observed Molecular Weight: 42 kDa
• GenBank Accession Number: BC024030
• Gene Symbol: FBXO32
• Gene ID (NCBI): 114907
• RRID: AB_2882468
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q969P5
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

FBXO32 (F box only protein 32), also known as Atrogin 1 or MAFbx, is a member of the F-box protein family which is characterized by an approximately 40 amino acid motif F-box. This protein is an E3 ubiquitin ligase that is markedly up-regulated in muscle atrophy. FBXO32 is thus a potential drug target for the treatment of muscle atrophy. Some data support that FBXO32 may play an important role in tumorigenesis. Recent study reveal that FBXO32 targets the oncogenic protein c-Myc for ubiquitination and degradation through the proteasome pathway.

Publications

What published studies show

The FBXO32 Monoclonal antibody (Cat# 67172-1-Ig) has 79 citations. Publications appear in journals including Nature Communications, J Cachexia Sarcopenia Muscle, Cell Death & Disease, Advanced Science, FASEB Journal, International Journal of Molecular Sciences, and Journal of Ethnopharmacology, among others. Research fields span muscle atrophy and sarcopenia, cancer cachexia, diabetes, exercise physiology, gut microbiota, aging, and cardiovascular disease.

Automatically generated from the 79 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Nat Commun; Early-life exercise extends healthspan but not lifespan in mice; Authors - Mengya Feng
human	IHC	Nat Commun; F-box protein FBXO32 ubiquitinates and stabilizes D-type cyclins to drive cancer progression; Authors - Feng Li
human	WB	Metabolism; Anti-sarcopenic effects of active vitamin D through modulation of anabolic and catabolic signaling pathways in human skeletal muscle: A randomized controlled trial; Authors - Tetsuya Kawahara
rat	WB	Adv Sci (Weinh); Burn-Induced Gut Microbiota Dysbiosis Aggravates Skeletal Muscle Atrophy by Tryptophan-Kynurenine Mediated AHR Pathway Activation; Authors - Shan Gao
human	WB,IHC	Cell Death Dis; FBXO32-mediated degradation of PTEN promotes lung adenocarcinoma progression; Authors - Jie Wu
mouse	WB	J Cachexia Sarcopenia Muscle; Mesenchymal stromal cells ameliorate diabetes-induced muscle atrophy through exosomes by enhancing AMPK/ULK1-mediated autophagy; Authors - Jia Song