CoraLite®594-conjugated FBXO32 Monoclonal antibody

FBXO32 Monoclonal Antibody for IF-P
Cat No. CL594-67172
Clone No.3C2G3

Host / Isotype

Mouse / IgG2b

Reactivity

Human, mouse

Applications

IF-P

Atrogin 1, F box only protein 32, F box protein 32, Fbx32, FBXO32, FLJ32424, MAFbx, Muscle atrophy F box protein

Formulation:  PBS and Azide
PBS and Azide
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF-P detected inmouse skeletal muscle tissue

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)-PIF-P : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL594-67172 targets FBXO32 in IF-P applications and shows reactivity with Human, mouse samples.

Tested Reactivity Human, mouse
Host / Isotype Mouse / IgG2b
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag25247

Product name: Recombinant human FBXO32 protein

Source: e coli.-derived, PET30a

Tag: 6*His

Domain: 1-216 aa of BC024030

Sequence: IAQKNFMNILEKVVLKVLEDQQNIRLIRELLQTLYTSLCTLVQRVGKSVLVGNINMWVYRMETILHWQQQLNNIQITRPAFKGLTFTDLPLCLQLNIMQRLSDGRDLVSLGQAAPDLHVLSEDRLLWKKLCQYHFSERQIRKRLILSDKGQLDWKKMYFKLVRCYPRKEQYGDTLQLRKHCHILSWKGTDHPCTANNPESCSVSLSPQDFINLFKF

Predict reactive species
Full Name F-box protein 32
Calculated Molecular Weight 355 aa, 42 kDa
Observed Molecular Weight 42 kDa
GenBank Accession NumberBC024030
Gene Symbol FBXO32
Gene ID (NCBI) 114907
RRIDAB_3084755
Conjugate CoraLite®594 Fluorescent Dye
Excitation/Emission Maxima Wavelengths588 nm / 604 nm
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ969P5
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

FBXO32 (F box only protein 32), also known as Atrogin 1 or MAFbx, is a member of the F-box protein family which is characterized by an approximately 40 amino acid motif F-box. This protein is an E3 ubiquitin ligase that is markedly up-regulated in muscle atrophy. FBXO32 is thus a potential drug target for the treatment of muscle atrophy. Some data support that FBXO32 may play an important role in tumorigenesis. Recent study reveal that FBXO32 targets the oncogenic protein c-Myc for ubiquitination and degradation through the proteasome pathway.

Protocols

Product Specific Protocols
IF protocol for CL594 FBXO32 antibody CL594-67172Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...