CoraLite® Plus 488-conjugated FBXO32 Monoclonal antibody

• 

  IF Staining of mouse skeletal muscle using CL488-67172

  Immunofluorescent analysis of (4% PFA) fixed mouse skeletal muscle tissue using CoraLite® Plus 488 FBXO32 antibody (CL488-67172, Clone: 3C2G3 ) at dilution of 1:200.

FBXO32 Monoclonal Antibody for IF-P

Cat No. CL488-67172

Clone No.3C2G3

Host / Isotype

Mouse / IgG2b

Reactivity

Human, mouse

Applications

IF-P

Synonyms

Atrogin 1, F box only protein 32, F box protein 32, Fbx32, FBXO32, FLJ32424, MAFbx, Muscle atrophy F box protein

---

Tested Applications

• Positive IF-P detected in: mouse skeletal muscle tissue

Recommended dilution

• Immunofluorescence (IF)-P: IF-P : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-67172 targets FBXO32 in IF-P applications and shows reactivity with Human, mouse samples.

• Tested Reactivity: Human, mouse
• Host / Isotype: Mouse / IgG2b
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag25247

  Product name: Recombinant human FBXO32 protein

  Source: e coli.-derived, PET30a

  Tag: 6*His

  Domain: 1-216 aa of BC024030

  Sequence: IAQKNFMNILEKVVLKVLEDQQNIRLIRELLQTLYTSLCTLVQRVGKSVLVGNINMWVYRMETILHWQQQLNNIQITRPAFKGLTFTDLPLCLQLNIMQRLSDGRDLVSLGQAAPDLHVLSEDRLLWKKLCQYHFSERQIRKRLILSDKGQLDWKKMYFKLVRCYPRKEQYGDTLQLRKHCHILSWKGTDHPCTANNPESCSVSLSPQDFINLFKF

• Full Name: F-box protein 32
• Calculated Molecular Weight: 355 aa, 42 kDa
• Observed Molecular Weight: 42 kDa
• GenBank Accession Number: BC024030
• Gene Symbol: FBXO32
• Gene ID (NCBI): 114907
• RRID: AB_3084320
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q969P5
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

FBXO32 (F box only protein 32), also known as Atrogin 1 or MAFbx, is a member of the F-box protein family which is characterized by an approximately 40 amino acid motif F-box. This protein is an E3 ubiquitin ligase that is markedly up-regulated in muscle atrophy. FBXO32 is thus a potential drug target for the treatment of muscle atrophy. Some data support that FBXO32 may play an important role in tumorigenesis. Recent study reveal that FBXO32 targets the oncogenic protein c-Myc for ubiquitination and degradation through the proteasome pathway.