• Featured Product
  • KD/KO Validated

CoraLite® Plus 488-conjugated FBXO6 Monoclonal antibody

FBXO6 Monoclonal Antibody for IF/ICC
Cat No. CL488-67697
Clone No.3B7F9

Host / Isotype

Mouse / IgG2b

Reactivity

human, mouse, rat

Applications

IF/ICC

3B7F9, F box only protein 6, F box protein 6, FBG2, F-box only protein 6

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHEK-293 cells
Positive FC (Intra) detected inJurkat cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-67697 targets FBXO6 in IF/ICC applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Mouse / IgG2b
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag30512

Product name: Recombinant human FBXO6 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-293 aa of BC020880

Sequence: MDAPHSKAALDSINELPENILLELFTHVPARQLLLNCRLVCSLWRDLIDLMTLWKRKCLREGFITKDWDQPVADWKIFYFLRSLHRNLLRNPCAEEDMFAWQIDFNGGDRWKVESLPGAHGTDFPDPKVKKYFVTSYEMCLKSQLVDLVAEGYWEELLDTFRPDIVVKDWFAARADCGCTYQLKVQLASADYFVLASFEPPPVTIQQWNNATWTEVSYTFSDYPRGVRYILFQHGGRDTQYWAGWYGPRVTNSSIVVSPKMTRNQASSEAQPGQKHGQEEAAQSPYRAVVQIF

Predict reactive species
Full Name F-box protein 6
Calculated Molecular Weight 293 aa, 34 kDa
Observed Molecular Weight34 kDa
GenBank Accession NumberBC020880
Gene Symbol FBXO6
Gene ID (NCBI) 26270
RRIDAB_2923782
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ9NRD1
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

FBXO6(F-box only protein 6 ) is also named as FBG2, FBS2, FBX6 and belongs to the F-box protein family. FBXO6 is the substrate recognition component of a Skp1-Cullin1-F-box protein (SCF) ubiquitin E3 ligase complex, recognizing the chitobiose in unfolded N-glycoprotein to target glycoproteins for polyubiquitination and degradation. It can regulate Chk1 ubiquitination and degradation in both normally cycling cells and during replication stress. This protein is mainly detected in the cytoplasm in both cultured cells and in tumor tissues. Its expression is a predictive biomarker of tumor responsiveness to the important anticancer drugs. Positive Fbxo6 expression correlated with early TNM stage and favorable prognosis of NSCLC patients. (PMID:19716789, PMID: 27855403, PMID: 31140586).

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 FBXO6 antibody CL488-67697Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...