CoraLite® Plus 488-conjugated FDFT1 Recombinant monoclonal antibody

FDFT1 Uni-rAb® Recombinant Antibody for IF/ICC
Cat No. CL488-83020-2
Clone No.230362F3

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IF/ICC

Farnesyl-diphosphate farnesyltransferase 1, Farnesyl-diphosphate farnesyltransferase, ERG9, EC:2.5.1.21, DGPT

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHepG2 cells
Positive FC (Intra) detected inU2OS cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-83020-2 targets FDFT1 in IF/ICC applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag3743

Product name: Recombinant human SQS protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-358 aa of BC029641

Sequence: MEFVKCLGHPEEFYNLVRFRIGGKRKVMPKMDQDSLSSSLKTCYKYLNQTSRSFAAVIQALDGEMRNAVCIFYLVLRALDTLEDDMTISVEKKVPLLHNFHSFLYQPDWRFMESKEKDRQVLEDFPTISLEFRNLAEKYQTVIADICRRMGIGMAEFLDKHVTSEQEWDKYCHYVAGLVGIGLSRLFSASEFEDPLVGEDTERANSMGLFLQKTNIIRDYLEDQQGGREFWPQEVWSRYVKKLGDFAKPENIDLAVQCLNELITNALHHIPDVITYLSRLRNQSVFNFCAIPQVMAIATLAACYNNQQVFKGAVKIRKGQAVTLMMDATNMPAVKAIIYQYMEEIYHRIPDSDPSSSK

Predict reactive species
Full Name farnesyl-diphosphate farnesyltransferase 1
Calculated Molecular Weight 417 aa, 48 kDa
GenBank Accession NumberBC029641
Gene Symbol FDFT1
Gene ID (NCBI) 2222
RRIDAB_3673172
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP37268
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

SQS (Squalene synthase), also known as Farnesyl-diphosphate farnesyltransferase 1 (FDFT1) is a gene that encodes the membrane-associated enzyme squalene synthase, which is the first specific enzyme in cholesterol biosynthesis. FDFT1 is highly expressed in liver, lung, prostate, breast, ovary, bladder, cervix, thyroid, and esophageal cancers, while in colorectal, colon, testicular, uterine, pancreas, and kidney tumors, its expression is downregulated (PMID: 35093030). FDFT1 is a key downstream target of the fasting response and may be involved in CRC cell glucose metabolism (PMID: 32313017).

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 FDFT1 antibody CL488-83020-2Download protocol
FC protocol for CL Plus 488 FDFT1 antibody CL488-83020-2Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...