Home
Products
Primary Antibodies
FGF1 Polyclonal antibody, PBS Only (17400-1-PBS)

FGF1 Polyclonal antibody, PBS Only

Name: FGF1 Polyclonal antibody, PBS Only,
Brand: Proteintech

FGF1 Polyclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 17400-1-PBS

Review Product

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

FGF-1, Endothelial cell growth factor, Fibroblast growth factor 1, HBGF-1, Heparin-binding growth factor 1

Formulation: PBS Only

PBS, Azide, Glycerol

Conjugate: Unconjugated

Size/Concentration:

SKU:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Filter: AllWBIHCIF/ICC

WB analysis using 17400-1-AP (same clone as 17400-1-PBS)
Various lysates were subjected to SDS PAGE followed by western blot with 17400-1-AP (FGF1 antibody) at dilution of 1:2500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 17400-1-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis using 17400-1-AP (same clone as 17400-1-PBS)
Various lysates were subjected to SDS PAGE followed by western blot with 17400-1-AP (FGF1 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 17400-1-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of mouse spinal cord using 17400-1-AP (same clone as 17400-1-PBS)
mouse spinal cord tissue were subjected to SDS PAGE followed by western blot with 17400-1-AP (FGF1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 17400-1-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human colon cancer using 17400-1-AP (same clone as 17400-1-PBS)
Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 17400-1-AP (FGF1 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 17400-1-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human colon cancer using 17400-1-AP (same clone as 17400-1-PBS)
Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 17400-1-AP (FGF1 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 17400-1-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human breast cancer using 17400-1-AP (same clone as 17400-1-PBS)
Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 17400-1-AP (FGF1 antibody) at dilution of 1:1000 (under 10x lens). This data was developed using the same antibody clone with 17400-1-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human breast cancer using 17400-1-AP (same clone as 17400-1-PBS)
Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 17400-1-AP (FGF1 antibody) at dilution of 1:1000 (under 40x lens). This data was developed using the same antibody clone with 17400-1-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human lung cancer using 17400-1-AP (same clone as 17400-1-PBS)
Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 17400-1-AP (FGF1 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 17400-1-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human lung cancer using 17400-1-AP (same clone as 17400-1-PBS)
Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 17400-1-AP (FGF1 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 17400-1-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of mouse brain using 17400-1-AP (same clone as 17400-1-PBS)
Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 17400-1-AP (FGF1 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 17400-1-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of mouse brain using 17400-1-AP (same clone as 17400-1-PBS)
Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 17400-1-AP (FGF1 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 17400-1-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of rat brain using 17400-1-AP (same clone as 17400-1-PBS)
Immunohistochemical analysis of paraffin-embedded rat brain tissue slide using 17400-1-AP (FGF1 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 17400-1-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of rat brain using 17400-1-AP (same clone as 17400-1-PBS)
Immunohistochemical analysis of paraffin-embedded rat brain tissue slide using 17400-1-AP (FGF1 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 17400-1-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of rat kidney using 17400-1-AP (same clone as 17400-1-PBS)
Immunohistochemical analysis of paraffin-embedded rat kidney tissue slide using 17400-1-AP (FGF1 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 17400-1-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of rat kidney using 17400-1-AP (same clone as 17400-1-PBS)
Immunohistochemical analysis of paraffin-embedded rat kidney tissue slide using 17400-1-AP (FGF1 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 17400-1-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IF Staining of HepG2 using 17400-1-AP (same clone as 17400-1-PBS)
Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using FGF1 antibody (17400-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L), CL594-phalloidin (red). This data was developed using the same antibody clone with 17400-1-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Overview

Tested Applications
Product Information

Print datasheet

MSDS SDS

Product Information

17400-1-PBS targets FGF1 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity	human, mouse, rat
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag11366 Product name: Recombinant human FGF1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-155 aa of BC032697 Sequence: MAEGEITTFTALTEKFNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD Predict reactive species
Full Name	fibroblast growth factor 1 (acidic)
Calculated Molecular Weight	155 aa, 17 kDa
Observed Molecular Weight	17 kDa
GenBank Accession Number	BC032697
Gene Symbol	FGF1
Gene ID (NCBI)	2246
RRID	AB_2103758
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	P05230
Storage Buffer	PBS only, pH 7.3.
Storage Conditions	Store at -80°C.

Background Information

Fibroblast growth factor 1 (FGF1), also known as acidic fibroblast growth factor (aFGF) and heparin-binding growth factor 1 (HBGF-1), is a 17-18 kDa signaling protein. As a member of the FGF family, it possesses broad mitogenic and cell survival activities, playing critical roles in embryonic development, tissue repair, angiogenesis, and organogenesis. FGF1 exerts its pleiotropic effects by binding to and activating its tyrosine kinase receptors, FGFR1 through FGFR4, in a process that is potentiated by cell-surface heparan sulfate proteoglycans. This activation initiates several downstream signaling cascades, including the MAPK/ERK and AKT pathways. Originally purified in 1975 and distinguished from its homolog FGF2 by its acidic isoelectric point, FGF1 is unique in that it lacks a classical signal peptide and is secreted via a non-classical, stress-induced pathway involving S100A13 and SYT1. Beyond its well-established extracellular functions in wound healing and as a potent inducer of DNA synthesis, FGF1 also possesses intracellular activities and can translocate to the nucleus to influence cell survival.