FGF1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• FGF1 Polyclonal antibody, PBS Only (17400-1-PBS)

• 

  WB analysis using 17400-1-AP (same clone as 17400-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 17400-1-AP (FGF1 antibody) at dilution of 1:2500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 17400-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse spinal cord using 17400-1-AP (same clone as 17400-1-PBS)

  mouse spinal cord tissue were subjected to SDS PAGE followed by western blot with 17400-1-AP (FGF1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 17400-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 17400-1-AP (same clone as 17400-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 17400-1-AP (FGF1 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 17400-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon cancer using 17400-1-AP (same clone as 17400-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 17400-1-AP (FGF1 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 17400-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon cancer using 17400-1-AP (same clone as 17400-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 17400-1-AP (FGF1 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 17400-1-PBS in a different storage buffer formulation.

• 

  IHC staining of rat kidney using 17400-1-AP (same clone as 17400-1-PBS)

  Immunohistochemical analysis of paraffin-embedded rat kidney tissue slide using 17400-1-AP (FGF1 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 17400-1-PBS in a different storage buffer formulation.

• 

  IHC staining of rat kidney using 17400-1-AP (same clone as 17400-1-PBS)

  Immunohistochemical analysis of paraffin-embedded rat kidney tissue slide using 17400-1-AP (FGF1 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 17400-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 17400-1-AP (same clone as 17400-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 17400-1-AP (FGF1 antibody) at dilution of 1:1000 (under 10x lens). This data was developed using the same antibody clone with 17400-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 17400-1-AP (same clone as 17400-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 17400-1-AP (FGF1 antibody) at dilution of 1:1000 (under 40x lens). This data was developed using the same antibody clone with 17400-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human lung cancer using 17400-1-AP (same clone as 17400-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 17400-1-AP (FGF1 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 17400-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human lung cancer using 17400-1-AP (same clone as 17400-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 17400-1-AP (FGF1 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 17400-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 17400-1-AP (same clone as 17400-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 17400-1-AP (FGF1 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 17400-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 17400-1-AP (same clone as 17400-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 17400-1-AP (FGF1 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 17400-1-PBS in a different storage buffer formulation.

• 

  IHC staining of rat brain using 17400-1-AP (same clone as 17400-1-PBS)

  Immunohistochemical analysis of paraffin-embedded rat brain tissue slide using 17400-1-AP (FGF1 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 17400-1-PBS in a different storage buffer formulation.

• 

  IHC staining of rat brain using 17400-1-AP (same clone as 17400-1-PBS)

  Immunohistochemical analysis of paraffin-embedded rat brain tissue slide using 17400-1-AP (FGF1 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 17400-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 17400-1-AP (same clone as 17400-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using FGF1 antibody (17400-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L), CL594-phalloidin (red). This data was developed using the same antibody clone with 17400-1-PBS in a different storage buffer formulation.

FGF1 Polyclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 17400-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

FGF-1, Endothelial cell growth factor, Fibroblast growth factor 1, HBGF-1, Heparin-binding growth factor 1

---

Product Information

17400-1-PBS targets FGF1 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag11366

  Product name: Recombinant human FGF1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-155 aa of BC032697

  Sequence: MAEGEITTFTALTEKFNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD

• Full Name: fibroblast growth factor 1 (acidic)
• Calculated Molecular Weight: 155 aa, 17 kDa
• Observed Molecular Weight: 17 kDa
• GenBank Accession Number: BC032697
• Gene Symbol: FGF1
• Gene ID (NCBI): 2246
• RRID: AB_2103758
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P05230
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.