FGF12 Monoclonal antibody

FGF12 Monoclonal Antibody for WB, FC (Intra), ELISA
Cat No. 60152-1-Ig
Clone No.2F11A10

Host / Isotype

Mouse / IgG2b

Reactivity

human

Applications

WB, FC (Intra), ELISA

FGF-12, 2F11A10, FGF 12, FHF1, FHF-1

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inmouse brain tissue, human brain tissue, rat brain tissue
Positive FC (Intra) detected inHeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2000-1:10000
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.80 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

60152-1-Ig targets FGF12 in WB, FC (Intra), ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Mouse / IgG2b
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag5046

Product name: Recombinant human FGF12 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-181 aa of BC022524

Sequence: MESKEPQLKGIVTRLFSQQGYFLQMHPDGTIDGTKDENSDYTLFNLIPVGLRVVAIQGVKASLYVAMNGEGYLYSSDVFTPECKFKESVFENYYVIYSSTLYRQQESGRAWFLGLNKEGQIMKGNRVKKTKPSSHFVPKPIEVCMYREQSLHEIGEKQGRSRKSSGTPTMNGGKVVNQDST

Predict reactive species
Full Name fibroblast growth factor 12
Calculated Molecular Weight 181 aa, 20 kDa
Observed Molecular Weight 20 kDa
GenBank Accession NumberBC022524
Gene Symbol FGF12
Gene ID (NCBI) 2257
RRIDAB_10644325
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP61328
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

FGF12 is a member of the fibroblast growth factor (FGF) family. FGF family members play important roles in embryogenesis, angiogenesis, and wound repair. FGF12 lacks the N-terminal signal sequence present in most of the FGF family members, but it contains clusters of basic residues that have been demonstrated to act as a nuclear localization signal. When transfected into mammalian cells, this protein accumulated in the nucleus, but was not secreted. FGF12 plays an intracellular role in the inhibition of radiation-induced apoptosis. FGF12 is expressed abundantly in developing and adult nervous systems; therefore, FGF12 was thought to be related to nervous system development and function.

Protocols

Product Specific Protocols
FC protocol for FGF12 antibody 60152-1-IgDownload protocol
WB protocol for FGF12 antibody 60152-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...