CoraLite® Plus 488-conjugated FKBP5 Monoclonal antibody

FKBP5 Monoclonal Antibody for IF/ICC, FC (Intra)
Cat No. CL488-67874
Clone No.3B11F3

Host / Isotype

Mouse / IgG2b

Reactivity

human, mouse, rat

Applications

IF/ICC, FC (Intra)

FKBP-51, 3B11F3, 51 kDa FK506-binding protein, 54 kDa progesterone receptor-associated immunophilin, AIG6

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHeLa cells
Positive FC (Intra) detected inK-562 cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-67874 targets FKBP5 in IF/ICC, FC (Intra) applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Mouse / IgG2b
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag5514

Product name: Recombinant human FKBP5 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-375 aa of BC042605

Sequence: MTTDEGAKNNEESPTATVAEQGEDITSKKDRGVLKIVKRVGNGEETPMIGDKVYVHYKGKLSNGKKFDSSHDRNEPFVFSLGKGQVIKAWDIGVATMKKGEICHLLCKPEYAYGSAGSLPKIPSNATLFFEIELLDFKGEDLFEDGGIIRRTKRKGEGYSNPNEGATVEIHLEGRCGGRMFDCRDVAFTVGEGEDHDIPIGIDKALEKMQREEQCILYLGPRYGFGEAGKPKFGIEPNAELIYEVTLKSFEKAKESWEMDTKEKLEQAAIVKEKGTVYFKGGKYMQAVIQYGKIVSWLEMEYGLSEKESKASESFLLAAFLNLAMCYLKLREYTKAVECCDKALGLDSANEKGLYRRGEAQLLMNEFESAKGDFE

Predict reactive species
Full Name FK506 binding protein 5
Calculated Molecular Weight 457 aa, 51 kDa
Observed Molecular Weight 51 kDa
GenBank Accession NumberBC042605
Gene Symbol FKBP5
Gene ID (NCBI) 2289
RRIDAB_2923812
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ13451
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

FKBP5(Peptidyl-prolyl cis-trans isomerase FKBP5 ) interacts with functionally mature heterooligomeric progesterone receptor complexes along with HSP90 and TEBP. Unlike the predominant T-cell expression of the mouse protein, FKBP5 is expressed as a 51-kD protein in a variety of tissues but not in brain, colon, or lung(PMID: 9125197).

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 FKBP5 antibody CL488-67874Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...