FOXA2 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• FOXA2 Polyclonal antibody, PBS Only (22474-1-PBS)

• 

  WB analysis using 22474-1-AP (same clone as 22474-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 22474-1-AP (FOXA2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 22474-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HepG2 using 22474-1-AP (same clone as 22474-1-PBS)

  WB result of FOXA2 antibody (22474-1-AP; 1:600; room temperature for 1.5 hours) with wild-type and sg-FOXA2 transfected HepG2 cells. This data was developed using the same antibody clone with 22474-1-PBS in a different storage buffer formulation.

• 

  IP experiment of HepG2 using 22474-1-AP (same clone as 22474-1-PBS)

  IP result of anti-FOXA2 (IP:22474-1-AP, 4ug; Detection:22474-1-AP 1:500) with HepG2 cells lysate 1320 ug. This data was developed using the same antibody clone with 22474-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon cancer using 22474-1-AP (same clone as 22474-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 22474-1-AP (FOXA2 antibody) at dilution of 1:4000 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 22474-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon cancer using 22474-1-AP (same clone as 22474-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 22474-1-AP (FOXA2 antibody) at dilution of 1:4000 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 22474-1-PBS in a different storage buffer formulation.

• 

  IF Staining of rat stomach using 22474-1-AP (same clone as 22474-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed rat stomach tissue using FOXA2 antibody (22474-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 22474-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

FOXA2 Polyclonal Antibody for WB, IHC, IF-P, IP, Indirect ELISA

Cat No. 22474-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF-P, IP, Indirect ELISA

Synonyms

forkhead box A2, Forkhead box protein A2, Hepatocyte nuclear factor 3-beta, HNF 3 beta, HNF 3B

---

Product Information

22474-1-PBS targets FOXA2 in WB, IHC, IF-P, IP, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag18221

  Product name: Recombinant human FOXA2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-160 aa of BC011780

  Sequence: MLGAVKMEGHEPSDWSSYYAEPEGYSSVSNMNAGLGMNGMNTYMSMSAAAMGSGSGNMSAGSMNMSSYVGAGMSPSLAGMSPGAGAMAGMGGSAGAAGVAGMGPHLSPSLSPLGGQAAGAMGGLAPYANMNSMSPMYGQAGLSRARDPKTYRRSYTHAKP

• Full Name: forkhead box A2
• Calculated Molecular Weight: 457 aa, 48 kDa
• Observed Molecular Weight: 55-65 kDa
• GenBank Accession Number: BC011780
• Gene Symbol: FOXA2
• Gene ID (NCBI): 3170
• RRID: AB_2879110
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9Y261
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

FOXA2 also named as HNF 3 beta or TCF3B is a 457 amino acid protein, which contains one fork-head DNA-binding domains. FOXA2 can Shuttle between the nucleus and cytoplasm in a CRM1-dependent manner. Phosphorylation on FOXA2 Thr-156 abolishes binding to target promoters and subsequent transcription activation upon INS stimulation. FOXA2 as a transcription factor involves in embryonic development, establishment of tissue-specific gene expression and regulation of gene expression in differentiated tissues. The molecular weight of FOXA2 is 48kDa, but the phosphorylated FOXA2 may be a 55-65kDa protein.