CoraLite® Plus 647-conjugated FOXG1 Recombinant monoclonal antibody

• 

  IF Staining of U-251 using CL647-85930

  Immunofluorescent analysis of (4% PFA) fixed U-251 cells using CoraLite® Plus 647 FOXG1 antibody (CL647-85930, Clone: 250144E8 ) at dilution of 1:200.

• 

  IF Staining of C6 using CL647-85930

  Immunofluorescent analysis of (4% PFA) fixed C6 cells using CoraLite® Plus 647 FOXG1 antibody (CL647-85930, Clone: 250144E8 ) at dilution of 1:200.

FOXG1 Uni-rAb^® Recombinant Antibody for IF/ICC

Cat No. CL647-85930

Clone No.250144E8

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IF/ICC

Synonyms

FOXG 1, BF-1, BF-2, forkhead box G1, Forkhead box protein G1

---

Tested Applications

• Positive IF/ICC detected in: U-251 cells, C6 cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL647-85930 targets FOXG1 in IF/ICC applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag17169

  Product name: Recombinant human FOXG1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 190-489 aa of BC035020

  Sequence: IMMAIRQSPEKRLTLNGIYEFIMKNFPYYRENKQGWQNSIRHNLSLNKCFVKVPRHYDDPGKGNYWMLDPSSDDVFIGGTTGKLRRRSTTSRAKLAFKRGARLTSTGLTFMDRAGSLYWPMSPFLSLHHPRASSTLSYNGTTSAYPSHPMPYSSVLTQNSLGNNHSFSTANGLSVDRLVNGEIPYATHHLTAAALAASVPCGLSVPCSGTYSLNPCSVNLLAGQTSYFFPHVPHPSMTSQSSTSMSARAASSSTSPQAPSTLPCESLRPSLPSFTTGLSGGLSDYFTHQNQGSSSNPLIH

• Full Name: forkhead box G1
• Calculated Molecular Weight: 489 aa, 52 kDa
• Observed Molecular Weight: 60 kDa
• GenBank Accession Number: BC035020
• Gene Symbol: FOXG1
• Gene ID (NCBI): 2290
• Conjugate: CoraLite® Plus 647 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 654 nm / 674 nm
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P55316
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

Forkhead Box G1 (FOXG1) is a member of the Forkhead family of genes with non-redundant roles in brain development, where alteration of this gene's expression significantly affects the formation and function of the mammalian cerebral cortex. FOXG1 haploinsufficiency in humans is associated with prominent differences in brain size and impaired intellectual development noticeable in early childhood, while homozygous mutations are typically fatal.