FOXS1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• FOXS1 Polyclonal antibody, PBS Only (16234-1-PBS)

• 

  WB analysis of mouse liver using 16234-1-AP (same clone as 16234-1-PBS)

  mouse liver tissue were subjected to SDS PAGE followed by western blot with 16234-1-AP (FOXS1 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 16234-1-PBS in a different storage buffer formulation.

• 

  WB analysis of rat liver using 16234-1-AP (same clone as 16234-1-PBS)

  rat liver tissue were subjected to SDS PAGE followed by western blot with 16234-1-AP (FOXS1 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 16234-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse liver using 16234-1-AP (same clone as 16234-1-PBS)

  mouse liver tissue were subjected to SDS PAGE followed by western blot with 16234-1-AP (FOXS1 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 16234-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse liver using 16234-1-AP (same clone as 16234-1-PBS)

  mouse liver tissue were subjected to SDS PAGE followed by western blot with 16234-1-AP (FOXS1 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 16234-1-PBS in a different storage buffer formulation.

FOXS1 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 16234-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

---

Product Information

16234-1-PBS targets FOXS1 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag8957

  Product name: Recombinant human FOXS1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-330 aa of BC013408

  Sequence: MQQQPLPGPGAPTTEPTKPPYSYIALIAMAIQSSPGQRATLSGIYRYIMGRFAFYRHNRPGWQNSIRHNLSLNECFVKVPRDDRKPGKGSYWTLDPDCHDMFEHGSFLRRRRRFTRQTGAEGTRGPAKARRGPLRATSQDPGVPNATTGRQCSFPPELPDPKGLSFGGLVGAMPASMCPATTDGRPRPPMEPKEISTPKPACPGELPVATSSSSCPAFGFPAGFSEAESFNKAPTPVLSPESGIGSSYQCRLQALNFCMGADPGLEHLLASAAPSPAPPTPPGSLRAPLPLPTDHKEPWVAGGFPVQGGSGYPLGLTPCLYRTPGMFFFE

• Full Name: forkhead box S1
• Calculated Molecular Weight: 330 aa, 35 kDa
• Observed Molecular Weight: 35 kDa
• GenBank Accession Number: BC013408
• Gene Symbol: FOXS1
• Gene ID (NCBI): 2307
• RRID: AB_2878234
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O43638
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.