FRAS1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• FRAS1 Polyclonal antibody, PBS Only (29654-1-PBS)

• 

  WB analysis of mouse brain using 29654-1-AP (same clone as 29654-1-PBS)

  mouse brain tissue were subjected to Tris-Acetate gel system followed by western blot with 29654-1-AP (FRAS1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 29654-1-PBS in a different storage buffer formulation.

FRAS1 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 29654-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, Indirect ELISA

Synonyms

---

Product Information

29654-1-PBS targets FRAS1 in WB, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag31229

  Product name: Recombinant human FRAS1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 242-388 aa of NM_025074

  Sequence: CICDRGEVRCHKQACLPLRCGKGQSRARRHGQCCEECVSPAGSCSYDGVVRYQDEMWKGSACEFCMCDHGQVTCQTGECAKVECARDEELIHLDGKCCPECISRNGYCVYEETGEFMSSNASEVKRIPEGEKWEDGPCKVCECRGAQ

• Full Name: Fraser syndrome 1
• Calculated Molecular Weight: 443 kDa
• Observed Molecular Weight: 450-500 kDa
• GenBank Accession Number: NM_025074
• Gene Symbol: FRAS1
• Gene ID (NCBI): 80144
• RRID: AB_3086149
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q86XX4
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

FRAS1 (extracellular matrix organizing protein FRAS1) is required for the regulation of epidermal-basement membrane adhesion responsible for proper organogenesis during embryonic development, and it is also involved in brain organization and function.