FRMD1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• FRMD1 Polyclonal antibody, PBS Only (31908-1-PBS)

• 

  WB analysis using 31908-1-AP (same clone as 31908-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 31908-1-AP (FRMD1 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 31908-1-PBS in a different storage buffer formulation.

• 

  WB analysis of K-562 using 31908-1-AP (same clone as 31908-1-PBS)

  WB result of FRMD1 antibody (31908-1-AP; 1:1000; incubated at room temperature for 1.5 hours) with sh-Control and sh-FRMD1 transfected K-562 cells. This data was developed using the same antibody clone with 31908-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

FRMD1 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 31908-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

FERM domain-containing protein 1

---

Product Information

31908-1-PBS targets FRMD1 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag36382

  Product name: Recombinant human FRMD1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 205-300 aa of BC137144

  Sequence: RYFEPHSYFPQWIITKRGIDYILRHMPTLHRERQGLSPKEAMLCFIQEACRLEDVPVHFFRLHKDKKEGRPTVILGLALRGVHIYQGKKLEIQLDG

• Full Name: FERM domain containing 1
• Observed Molecular Weight: 70 kDa
• GenBank Accession Number: BC137144
• Gene Symbol: FRMD1
• Gene ID (NCBI): 79981
• RRID: AB_3742491
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q8N878
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

The FERM structural domain of FRMD1 (FERM Domain Containing 1) is widely found in cytoskeleton-associated proteins, which are capable of connecting the cytoskeleton to the cell membrane and is involved in signaling. FRMD1 is predicted to be involved in the positive regulation of the Hippo signaling pathway and may play a role in the cytoplasmic side of the cytoskeleton and apical plasma membrane. Although there are fewer studies on the role of FRMD1 in disease, its expression pattern in cancer and lymphoid tissues suggests that it may have important biological functions.