Product Information
24085-1-PBS targets FRYL in WB, Indirect ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag21333 Product name: Recombinant human FRYL protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 2605-2654 aa of BC021803 Sequence: MPEPLAPESYPESVCEEDVTLALKELDERCEEEEADFSGLSSQDEEEQDG Predict reactive species |
| Full Name | FRY-like |
| Calculated Molecular Weight | 3013 aa, 340 kDa |
| Observed Molecular Weight | 340 kDa |
| GenBank Accession Number | BC021803 |
| Gene Symbol | FRYL |
| Gene ID (NCBI) | 285527 |
| RRID | AB_3742103 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen Affinity purified |
| UNIPROT ID | O94915 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
FRYL, or FRY-like transcription coactivator, is a protein that belongs to the Furry protein family, which is evolutionarily conserved from yeast to humans. FRYL has almost identical functional domains to the well-characterized Fry protein, which is involved in many processes, including cell polarization, regulation of the actin cytoskeleton, and patterning of sensory neuron dendritic fields (PMID: 34386489). FRYL is a prognostic marker in certain cancers, including Kidney renal clear cell carcinoma, Ovary serous cystadenocarcinoma, and Rectum adenocarcinoma, suggesting its potential role in cancer progression.

