FSD1L Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• FSD1L Polyclonal antibody, PBS Only (21032-1-PBS)

• 

  IHC staining of human brain using 21032-1-AP (same clone as 21032-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human brain using 21032-1-AP (FSD1L antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 21032-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human brain using 21032-1-AP (same clone as 21032-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human brain using 21032-1-AP (FSD1L antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 21032-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 21032-1-AP (same clone as 21032-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using FSD1L antibody (21032-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 21032-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 21032-1-AP (same clone as 21032-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using FSD1L antibody (21032-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 21032-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HEK-293 using 21032-1-AP (same clone as 21032-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed HEK-293 cells using FSD1L antibody (21032-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 21032-1-PBS in a different storage buffer formulation.

FSD1L Polyclonal Antibody for IHC, IF/ICC, Indirect ELISA

Cat No. 21032-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IHC, IF/ICC, Indirect ELISA

Synonyms

FSD1-like protein, FSD1CL, FSD1 N-terminal-like protein, CSDUFD1, Coiled-coil domain-containing protein 10

---

Product Information

21032-1-PBS targets FSD1L in IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag15345

  Product name: Recombinant human FSD1L protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 418-530 aa of BC036746

  Sequence: TSWCIHVNNWLQNTFAAKHNNKVKALDVTVPEKIGVFCDFDGGQLSFYDANSKQLLYSFKTKFTQPVLPGFMVWCGGLSLSTGMQVPSAVRTLQKSENGMTGSASSLNNVVTQ

• Full Name: fibronectin type III and SPRY domain containing 1-like
• Calculated Molecular Weight: 530 aa, 60 kDa
• Observed Molecular Weight: 56-65 kDa
• GenBank Accession Number: BC036746
• Gene Symbol: FSD1L
• Gene ID (NCBI): 83856
• RRID: AB_10732808
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9BXM9
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.