Product Information
21032-1-PBS targets FSD1L in IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag15345 Product name: Recombinant human FSD1L protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 418-530 aa of BC036746 Sequence: TSWCIHVNNWLQNTFAAKHNNKVKALDVTVPEKIGVFCDFDGGQLSFYDANSKQLLYSFKTKFTQPVLPGFMVWCGGLSLSTGMQVPSAVRTLQKSENGMTGSASSLNNVVTQ Predict reactive species |
| Full Name | fibronectin type III and SPRY domain containing 1-like |
| Calculated Molecular Weight | 530 aa, 60 kDa |
| Observed Molecular Weight | 56-65 kDa |
| GenBank Accession Number | BC036746 |
| Gene Symbol | FSD1L |
| Gene ID (NCBI) | 83856 |
| RRID | AB_10732808 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9BXM9 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |









