FSTL3/FLRG Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• FSTL3/FLRG Polyclonal antibody, PBS Only (28218-1-PBS)

• 

  WB analysis using 28218-1-AP (same clone as 28218-1-PBS)

  Human placenta tissues were subjected to SDS PAGE followed by western blot with 28218-1-AP (FSTL3 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 28218-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 28218-1-AP (same clone as 28218-1-PBS)

  WB result of FSTL3 antibody (28218-1-AP; 1:400; incubated at room temperature for 1.5 hours) with sh-Control and sh-FSTL3 transfected HeLa cells. This data was developed using the same antibody clone with 28218-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human urothelial carcinoma using 28218-1-AP (same clone as 28218-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human urothelial carcinoma tissue slide using 28218-1-AP (FSTL3 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 28218-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human urothelial carcinoma using 28218-1-AP (same clone as 28218-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human urothelial carcinoma tissue slide using 28218-1-AP (FSTL3 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 28218-1-PBS in a different storage buffer formulation.

• 

  IHC staining of rat kidney using 28218-1-AP (same clone as 28218-1-PBS)

  Immunohistochemical analysis of paraffin-embedded rat kidney tissue slide using 28218-1-AP (FSTL3 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 28218-1-PBS in a different storage buffer formulation.

• 

  IHC staining of rat kidney using 28218-1-AP (same clone as 28218-1-PBS)

  Immunohistochemical analysis of paraffin-embedded rat kidney tissue slide using 28218-1-AP (FSTL3 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 28218-1-PBS in a different storage buffer formulation.

• 

  IHC staining of rat testis using 28218-1-AP (same clone as 28218-1-PBS)

  Immunohistochemical analysis of paraffin-embedded rat testis tissue slide using 28218-1-AP (FSTL3 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 28218-1-PBS in a different storage buffer formulation.

• 

  IHC staining of rat testis using 28218-1-AP (same clone as 28218-1-PBS)

  Immunohistochemical analysis of paraffin-embedded rat testis tissue slide using 28218-1-AP (FSTL3 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 28218-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

FSTL3/FLRG Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 28218-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

FLRG, FSTL3, Follistatin-related protein 3, Follistatin-related gene protein, Follistatin-like protein 3

---

Product Information

28218-1-PBS targets FSTL3/FLRG in WB, IHC, Indirect ELISA applications and shows reactivity with human, rat samples.

• Tested Reactivity: human, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag27626

  Product name: Recombinant human FSTL3 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 94-263 aa of BC005839

  Sequence: PCKDSCDGVECGPGKACRMLGGRPRCECAPDCSGLPARLQVCGSDGATYRDECELRAARCRGHPDLSVMYRGRCRKSCEHVVCPRPQSCVVDQTGSAHCVVCRAAPCPVPSSPGQELCGNNNVTYISSCHMRQATCFLGRSIGVRHAGSCAGTPEEPPGGESAEEEENFV

• Full Name: follistatin-like 3 (secreted glycoprotein)
• Calculated Molecular Weight: 263 aa, 28 kDa
• Observed Molecular Weight: 28-33 kDa
• GenBank Accession Number: BC005839
• Gene Symbol: FSTL3
• Gene ID (NCBI): 10272
• RRID: AB_3086037
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O95633
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Follistatin‐like 3 (FSTL3) is a highly conserved 27-39 kDa monomeric glycoprotein belonging to the follistatin protein family and it is primarily expressed in the placenta as well as in the testis, heart, adipose tissue, and pancreas. It is an extracellular inhibitor of the transforming growth factor beta (TGF‐β) family ligands, including activin, myostatin, and bone morphogenetic proteins.