FTSJ1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• FTSJ1 Polyclonal antibody, PBS Only (11620-1-PBS)

• 

  WB analysis of HeLa using 11620-1-AP (same clone as 11620-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 11620-1-AP (FTSJ1 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11620-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver using 11620-1-AP (same clone as 11620-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 11620-1-AP (FTSJ1 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 11620-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver using 11620-1-AP (same clone as 11620-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 11620-1-AP (FTSJ1 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 11620-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 11620-1-AP (same clone as 11620-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 11620-1-AP (FTSJ1 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 11620-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 11620-1-AP (same clone as 11620-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 11620-1-AP (FTSJ1 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 11620-1-PBS in a different storage buffer formulation.

• 

  IF Staining of A431 using 11620-1-AP (same clone as 11620-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed A431 cells using FTSJ1 antibody (11620-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 11620-1-PBS in a different storage buffer formulation.

FTSJ1 Polyclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 11620-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

---

Product Information

11620-1-PBS targets FTSJ1 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2199

  Product name: Recombinant human FTSJ1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-329 aa of BC023584

  Sequence: MGRTSKDKRDVYYRLAKENGWRARSAFKLLQLDKEFQLFQGVTRAVDLCAAPGSWSQVLSQKIGGQGSGHVVAVDLQAMAPLPGVVQIQGDITQLSTAKEIIQHFKGCPADLVVCDGAPDVTGLHDVDEYMQAQLLLAALNIATHVLKPGGCFVAKIFRGRDVTLLYSQLQVFFSSVLCAKPRSSRNSSIEAFAVCQGYDPPEGFIPDLSKPLLDHSYDPDFNQLDGPTRIIVPFVTCGDLSSYDSDRSYPLDLEGGSEYKYTPPTQPPISPPYQEACTLKRKGQLAKEIRPQDCPISRVDTFPQPLAAPQCHTLLAPEMEDNEMSCSP

• Full Name: FtsJ homolog 1 (E. coli)
• Calculated Molecular Weight: 329 aa, 36 kDa
• Observed Molecular Weight: 36 kDa
• GenBank Accession Number: BC023584
• Gene Symbol: FTSJ1
• Gene ID (NCBI): 24140
• RRID: AB_2877785
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9UET6
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.