CoraLite® Plus 488-conjugated FTSJD2 Polyclonal antibody

FTSJD2 Polyclonal Antibody for IF/ICC, FC (Intra)
Cat No. CL488-27707

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IF/ICC, FC (Intra)

FtsJ methyltransferase domain-containing protein 2, EC:2.1.1.57, CMTR1, Cap-specific mRNA (nucleoside-2'-O-)-methyltransferase 1, Cap1 2'O-ribose methyltransferase 1

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inU2OS cells
Positive FC (Intra) detected inU-251 cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.80 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-27707 targets FTSJD2 in IF/ICC, FC (Intra) applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag26722

Product name: Recombinant human FTSJD2 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 499-835 aa of BC031890

Sequence: SNESHCSLQIKALAKIHAFVQDTTLSEPRQAEIRKECLRLWGIPDQARVAPSSSDPKSKFFELIQGTEIDIFSYKPTLLTSKTLEKIRPVFDYRCMVSGSEQKFLIGLGKSQIYTWDGRQSDRWIKLDLKTELPRDTLLSVEIVHELKGEGKAQRKISAIHILDVLVLNGTDVREQHFNQRIQLAEKFVKAVSKPSRPDMNPIRVKEVYRLEEMEKIFVRLEMKIIKGSSGTPKLSYTGRDDRHFVPMGLYIVRTVNEPWTMGFSKSFKKKFFYNKKTKDSTFDLPADSIAPFHICYYGRLFWEWGDGIRVHDSQKPQDQDKLSKEDVLSFIQMHRA

Predict reactive species
Full Name FtsJ methyltransferase domain containing 2
Calculated Molecular Weight 835 aa, 95 kDa
Observed Molecular Weight 96-100 kDa
GenBank Accession NumberBC031890
Gene Symbol FTSJD2
Gene ID (NCBI) 23070
RRIDAB_3672815
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
Excitation LaserBlue laser (488 nm)
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ8N1G2
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

Cap1 2′-O-methylation is catalyzed by cap methyltransferase 1 (CMTR1). CMTR1, also called IFN-stimulated gene 95 kDa protein (ISG95) or FTSJD2, is elevated by a viral infection and required to promote IFN-mediated induction of ISGs and the antiviral response. High CMTR1 expression is associated with poor prognosis in patients with CRC (PMID: 37024465). CMTr1 binds ATP-dependent RNA DHX15 helicase and that this interaction, mediated by the G-patch domain of CMTr1, has an advantageous effect on CMTr1 activity towards highly structured RNA substrates (PMID: 30397098).). Human CMTR1 is a 95 kDa nuclear protein that has multiple domains, consisting of a G-patch domain, a RrmJ/FtsJ methyltransferase domain, a non-functional cap guanylyltransferase-like domain and a WW domain (PMID: 30312682).

Protocols

Product Specific Protocols
FC protocol for CL Plus 488 FTSJD2 antibody CL488-27707Download protocol
IF protocol for CL Plus 488 FTSJD2 antibody CL488-27707Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...