Featured Product
KD/KO Validated

FZR1/Cdh1 Polyclonal antibody

FZR1/Cdh1 Polyclonal Antibody for WB, IHC, IF/ICC, FC (Intra), IP, ELISA

Cat No. 16368-1-AP

Publications(15)

Reviews (1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, FC (Intra), IP, ELISA

Synonyms

FZR1, CDC20 like protein 1, CDC20C, CDC20-like protein 1, CDH1

Formulation: PBS, Azide, Glycerol

PBS, Azide, Glycerol

Conjugate: Unconjugated

Unconjugated

Size/Concentration:

SKU:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Filter: AllWBIPIHCIF/ICCFC (Intra)

WB analysis using 16368-1-AP
Various lysates were subjected to SDS PAGE followed by western blot with 16368-1-AP (FZR1/Cdh1 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis using 16368-1-AP
Various lysates were subjected to SDS PAGE followed by western blot with 16368-1-AP (FZR1/Cdh1 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of mouse liver using 16368-1-AP
mouse liver tissue were subjected to SDS PAGE followed by western blot with 16368-1-AP (FZR1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of C6 using 16368-1-AP
C6 cells were subjected to SDS PAGE followed by western blot with 16368-1-AP (FZR1 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of HepG2 using 16368-1-AP
HepG2 cells were subjected to SDS PAGE followed by western blot with 16368-1-AP (FZR1 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IP experiment of mouse heart using 16368-1-AP
IP result of anti-FZR1/Cdh1 (IP:16368-1-AP, 4ug; Detection:16368-1-AP 1:500) with mouse heart tissue lysate 3200ug.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human liver using 16368-1-AP
Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 16368-1-AP (FZR1 antibody) at dilution of 1:200 (under 10x lens).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human liver using 16368-1-AP
Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 16368-1-AP (FZR1 antibody) at dilution of 1:200 (under 40x lens).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of mouse heart using 16368-1-AP
Immunohistochemical analysis of paraffin-embedded mouse heart tissue slide using 16368-1-AP (FZR1/Cdh1 antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of mouse kidney using 16368-1-AP
Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 16368-1-AP (FZR1/Cdh1 antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of mouse liver using 16368-1-AP
Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 16368-1-AP (FZR1/Cdh1 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human ovary cancer using 16368-1-AP
Immunohistochemical analysis of paraffin-embedded human ovary cancer tissue slide using 16368-1-AP (FZR1/Cdh1 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of mouse kidney using 16368-1-AP
Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 16368-1-AP (FZR1/Cdh1 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of rat heart using 16368-1-AP
Immunohistochemical analysis of paraffin-embedded rat heart tissue slide using 16368-1-AP (FZR1/Cdh1 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of rat kidney using 16368-1-AP
Immunohistochemical analysis of paraffin-embedded rat kidney tissue slide using 16368-1-AP (FZR1/Cdh1 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of rat liver using 16368-1-AP
Immunohistochemical analysis of paraffin-embedded rat liver tissue slide using 16368-1-AP (FZR1/Cdh1 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human breast cancer using 16368-1-AP
Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 16368-1-AP (FZR1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human breast cancer using 16368-1-AP
Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 16368-1-AP (FZR1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IF Staining of HepG2 using 16368-1-AP
Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using 16368-1-AP (FZR1 antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IF Staining of HeLa using 16368-1-AP
Immunofluorescent analysis of (10% Formaldehyde) fixed HeLa cells using 16368-1-AP (FZR1 antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
FC experiment of HeLa using 16368-1-AP
1X10^6 HeLa cells were intracellularly stained with 0.2 ug Anti-Human FZR1/Cdh1 (16368-1-AP) and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) at dilution 1:1000 (red), or 0.2 ug Control Antibody. Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Overview

Tested Applications
Product Information
Publications (15)
Protocols
Reviews (1)

Print datasheet

MSDS SDS

Tested Applications

Positive WB detected in	HMy2.CIR cells, C6 cells, HEK-293 cells, HepG2 cells, mouse liver tissue, HeLa cells, NIH/3T3 cells, mouse heart tissue, rat heart tissue, Jurkat cells
Positive IP detected in	mouse heart tissue
Positive IHC detected in	mouse kidney tissue, human breast cancer tissue, human liver tissue, mouse heart tissue **Note: suggested antigen retrieval with TE buffer pH 9.0; () Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0***
Positive IF/ICC detected in	HepG2 cells, HeLa cells
Positive FC (Intra) detected in	HeLa cells

Recommended dilution

Application	Dilution
Western Blot (WB)	WB : 1:1000-1:6000
Immunoprecipitation (IP)	IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)	IHC : 1:200-1:800
Immunofluorescence (IF)/ICC	IF/ICC : 1:50-1:500
Flow Cytometry (FC) (INTRA)	FC (INTRA) : 0.20 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

16368-1-AP targets FZR1/Cdh1 in WB, IHC, IF/ICC, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity	human, mouse, rat
Cited Reactivity	human, mouse
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag9201 Product name: Recombinant human FZR1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 217-342 aa of BC013413 Sequence: SQVTRLCDLSVEGDSVTSVGWSERGNLVAVGTHKGFVQIWDAAAGKKLSMLEGHTARVGALAWNAEQLSSGSRDRMILQRDIRTPPLQSERRLQGHRQEVCGLKWSTDHQLLASGGNDNKLLVWNH Predict reactive species
Full Name	fizzy/cell division cycle 20 related 1 (Drosophila)
Calculated Molecular Weight	493 aa, 55 kDa
Observed Molecular Weight	55 kDa
GenBank Accession Number	BC013413
Gene Symbol	FZR1
Gene ID (NCBI)	51343
RRID	AB_2107380
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	Q9UM11
Storage Buffer	PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions	Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

FZR1 gene, also named as FYR, FZR and KIAA1242, has been previously shown to be mutated in lobular breast carcinomas. Direct evidence of FZR1 mutations triggering tumorigenesis has been investigated. FZR1 is a key regulator of ligase activity of the anaphase promoting complex/cyclosome (APC/C) which is playing vital role s in cell cycle progression. There are 7 WD-repeat domains in FZR1. Upon phosphorylation and dephosphorylation, it interacts with other components to modulate cell mitosis. This gene is different to E-cadherin (CDH1)which is an epithelial cell adhesion molecule. It has 55 kDa, 54 kDa and 45 kDa isoforms.

Protocols

Product Specific Protocols
FC protocol for FZR1/Cdh1 antibody 16368-1-AP	Download protocol
IF protocol for FZR1/Cdh1 antibody 16368-1-AP	Download protocol
IHC protocol for FZR1/Cdh1 antibody 16368-1-AP	Download protocol
IP protocol for FZR1/Cdh1 antibody 16368-1-AP	Download protocol
WB protocol for FZR1/Cdh1 antibody 16368-1-AP	Download protocol

Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

Species	Application	Title
human	WB	Signal Transduct Target Ther Phosphorylation determines the glucose metabolism reprogramming and tumor-promoting activity of sine oculis homeobox 1 Authors - Yanni Lin View Article
human	WB	Nat Cell Biol Phase separation of ERCC6L2-CtIP regulates the extent of DNA end resection Authors - Yixin Yin KD Validated View Article
human	WB	Nat Commun DNA replication initiation factor RECQ4 possesses a role in antagonizing DNA replication initiation Authors - Xiaohua Xu View Article
human	WB	Nat Chem Biol Molecular recording of cellular protein kinase activity with chemical labeling Authors - De-En Sun KD Validated View Article
		Adv Sci (Weinh) CDH1 Orchestrates Anabolic Events to Promote Cell Cycle Initiation Authors - Yun-Zi Mao View Article
mouse,human	WB	Adv Sci (Weinh) CDC20-Mediated Selective Autophagy Degradation of PBRM1 Affects Immunotherapy for Renal Cell Carcinoma Authors - Yizeng Fan View Article