G2E3 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• G2E3 Polyclonal antibody, PBS Only (34058-1-PBS)

• 

  IP experiment of mouse brain using 34058-1-AP (same clone as 34058-1-PBS)

  IP result of anti-G2E3 (IP:34058-1-AP, 4ug; Detection:34058-1-AP 1:500) with mouse brain tissue lysate 1960 ug. This data was developed using the same antibody clone with 34058-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human kidney using 34058-1-AP (same clone as 34058-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 34058-1-AP (G2E3 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 34058-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human kidney using 34058-1-AP (same clone as 34058-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 34058-1-AP (G2E3 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 34058-1-PBS in a different storage buffer formulation.

G2E3 Polyclonal Antibody for IHC, IP, Indirect ELISA

Cat No. 34058-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IHC, IP, Indirect ELISA

Synonyms

KIAA1333, PHF7B

---

Product Information

34058-1-PBS targets G2E3 in IHC, IP, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag40477

  Product name: Recombinant human G2E3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 231-340 aa of BC000973

  Sequence: ERCDVRRCRCKEGRDYNAPDSKWEIKRCQCCGSSGTHLACSSLRSWEQNWECLECRGIIYNSGEFQKAKKHVLPNSNNVGITDCLLEESSPKLPRQSPGSQSKDLLRQGS

• Full Name: G2/M-phase specific E3 ubiquitin ligase
• Calculated Molecular Weight: 706 aa, 81 kDa
• Observed Molecular Weight: 80 kDa
• GenBank Accession Number: BC000973
• Gene Symbol: G2E3
• Gene ID (NCBI): 55632
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q7L622
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

G2/M-phase specific E3 ubiquitin protein ligase (G2E3) is a cell cycle-regulated E3 ubiquitin ligase that plays a critical role in controlling the G2/M transition. It functions by targeting specific substrates for proteasomal degradation during late G2 and M phases, thereby ensuring proper cell cycle progression. G2E3 contains a RING finger domain, characteristic of E3 ubiquitin ligases, and its expression is tightly regulated in a cell cycle-dependent manner, peaking during G2/M phases. Research has implicated G2E3 in various cellular processes, including DNA damage response and mitotic regulation (PMID: 17239372; PMID: 18511420; PMID: 41068090).