GABRA5 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• GABRA5 Polyclonal antibody, PBS Only (27929-1-PBS)

• 

  WB analysis using 27929-1-AP (same clone as 27929-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 27929-1-AP (GABRA5 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 27929-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 27929-1-AP (same clone as 27929-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 27929-1-AP (GABRA5 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 27929-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 27929-1-AP (same clone as 27929-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 27929-1-AP (GABRA5 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 27929-1-PBS in a different storage buffer formulation.

• 

  IF Staining of mouse brain using 27929-1-AP (same clone as 27929-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed frozen OCT-embedded mouse brain tissue using GABRA5 antibody (27929-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 27929-1-PBS in a different storage buffer formulation.

GABRA5 Polyclonal Antibody for WB, IHC, IF-Fro, Indirect ELISA

Cat No. 27929-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF-Fro, Indirect ELISA

Synonyms

GABA A receptor alpha 5, GABA(A) receptor subunit alpha-5, GABAA receptor alpha 5, GABAAR subunit alpha-5, Gamma-aminobutyric acid receptor subunit alpha-5

---

Product Information

27929-1-PBS targets GABRA5 in WB, IHC, IF-Fro, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag27376

  Product name: Recombinant human GABRA5 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 36-222 aa of BC113422

  Sequence: SSVKDETNDNITIFTRILDGLLDGYDNRLRPGLGERITQVRTDIYVTSFGPVSDTEMEYTIDVFFRQSWKDERLRFKGPMQRLPLNNLLASKIWTPDTFFHNGKKSIAHNMTTPNKLLRLEDDGTLLYTMRLTISAECPMQLEDFPMDAHACPLKFGSYAYPNSEVVYVWTNGSTKSVVVAEDGSRL

• Full Name: gamma-aminobutyric acid (GABA) A receptor, alpha 5
• Calculated Molecular Weight: 462 aa, 52 kDa
• Observed Molecular Weight: 52 kDa
• GenBank Accession Number: BC113422
• Gene Symbol: GABRA5
• Gene ID (NCBI): 2558
• RRID: AB_2923580
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P31644
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.