GAGE7 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• GAGE7 Polyclonal antibody, PBS Only (12945-1-PBS)

• 

  WB analysis using 12945-1-AP (same clone as 12945-1-PBS)

  LNCaP cells were subjected to SDS PAGE followed by western blot with 12945-1-AP (GAGE7 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12945-1-PBS in a different storage buffer formulation.

• 

  WB analysis of LNCaP using 12945-1-AP (same clone as 12945-1-PBS)

  WB result of GAGE7 antibody (12945-1-AP; 1:600; incubated at room temperature for 1.5 hours) with sh-Control and sh-GAGE7 transfected LNCaP cells. This data was developed using the same antibody clone with 12945-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 12945-1-AP (same clone as 12945-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 12945-1-AP (GAGE7 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12945-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human gliomas using 12945-1-AP (same clone as 12945-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human gliomas tissue slide using 12945-1-AP (GAGE7 Antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 12945-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human gliomas using 12945-1-AP (same clone as 12945-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human gliomas tissue slide using 12945-1-AP (GAGE7 Antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 12945-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human prostate cancer using 12945-1-AP (same clone as 12945-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 12945-1-AP (GAGE7 Antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 12945-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human prostate cancer using 12945-1-AP (same clone as 12945-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 12945-1-AP (GAGE7 Antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 12945-1-PBS in a different storage buffer formulation.

GAGE7 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 12945-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, Indirect ELISA

Synonyms

AL4, Cancer/testis antigen 4.7, CT4.7, G antigen 12F, G antigen 7

---

Product Information

12945-1-PBS targets GAGE7 in WB, IHC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag4018

  Product name: Recombinant human GAGE7 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-117 aa of BC031628

  Sequence: MSWRGRSTYYWPRPRRYVQPPEMIGPMRPEQFSDEVEPATPEEGEPATQRQDPAAAQEGEDEGASAGQGPKPEAHSQEQGHPQTGCECEDGPDGQEMDPPNPEEVKTPEEGEKQSQC

• Full Name: G antigen 7
• Calculated Molecular Weight: 13 kDa
• Observed Molecular Weight: 26 kDa
• GenBank Accession Number: BC031628
• Gene Symbol: GAGE7
• Gene ID (NCBI): 2579
• RRID: AB_2877895
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O76087
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

GAGE7 (G Antigen 7), also known as CT4.7 or GAGE-7, is a cancer-testis antigen belonging to the GAGE family. It is predominantly expressed in germ cells of the testis and various tumors, including melanoma, lung, and breast cancers, while remaining silent in normal adult tissues (PMID: 10397259). GAGE7 is an intrinsically disordered protein (IDP) of 117 amino acids with a theoretical molecular weight of ~13 kDa; however, it exhibits an apparent molecular weight of ~26 kDa in SDS-PAGE due to its abnormal electrophoretic mobility (PMID: 23029259).