CoraLite® Plus 594-conjugated GALNT2 Polyclonal antibody

• 

  IF Staining of HeLa using CL594-17441

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using CoraLite® Plus 594 GALNT2 antibody (CL594-17441) at dilution of 1:200.

GALNT2 Polyclonal Antibody for IF/ICC

Cat No. CL594-17441

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IF/ICC

Synonyms

GalNAc T2, GALNT2, pp GaNTase 2

---

Tested Applications

• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL594-17441 targets GALNT2 in IF/ICC applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag11523

  Product name: Recombinant human GALNT2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 222-571 aa of BC041120

  Sequence: FLDSHCECNEHWLEPLLERVAEDRTRVVSPIIDVINMDNFQYVGASADLKGGFDWNLVFKWDYMTPEQRRSRQGNPVAPIKTPMIAGGLFVMDKFYFEELGKYDMMMDVWGGENLEISFRVWQCGGSLEIIPCSRVGHVFRKQHPYTFPGGSGTVFARNTRRAAEVWMDEYKNFYYAAVPSARNVPYGNIQSRLELRKKLSCKPFKWYLENVYPELRVPDHQDIAFGALQQGTNCLDTLGHFADGVVGVYECHNAGGNQEWALTKEKSVKHMDLCLTVVDRAPGSLIKLQGCRENDSRQKWEQIEGNSKLRHVGSNLCLDSRTAKSGGLSVEVCGPALSQQWKFTLNLQQ

• Full Name: UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 2 (GalNAc-T2)
• Calculated Molecular Weight: 571 aa, 65 kDa
• Observed Molecular Weight: 64 kDa
• GenBank Accession Number: BC041120
• Gene Symbol: GALNT2
• Gene ID (NCBI): 2590
• RRID: AB_3673427
• Conjugate: CoraLite® Plus 594 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 594 nm / 615 nm
• Form: Liquid
• Purification Method: Antigen Affinity Purified
• UNIPROT ID: Q10471
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

GALNT2, a GalNAc-transferase involved in O-linked glycosylation, modulates the risk of atherogenic dyslipidemia, a specific hallmark of insulin resistance and acts as a positive modulator of insulin signaling in human liver cells by down-regulating ENPP1. GALNT2 gene encodes GalNAc-T2 as a regulator of high-density lipoprotein cholesterol (HDL-C) metabolism (PMID: 31040393, 27508872). Western blot analysis detected GALNT2 at an apparent molecular mass of 64 kDa.