GANAB Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• GANAB Polyclonal antibody, PBS Only (29183-1-PBS)

• 

  WB analysis using 29183-1-AP (same clone as 29183-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 29183-1-AP (GANAB antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 29183-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 29183-1-AP (same clone as 29183-1-PBS)

  WB result of GANAB antibody (29183-1-AP; 1:4000; incubated at room temperature for 1.5 hours) with sh-Control and sh-GANAB transfected HeLa cells. This data was developed using the same antibody clone with 29183-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon using 29183-1-AP (same clone as 29183-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human normal colon slide using 29183-1-AP (GANAB antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 29183-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse liver using 29183-1-AP (same clone as 29183-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 29183-1-AP (GANAB antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 29183-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse liver using 29183-1-AP (same clone as 29183-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 29183-1-AP (GANAB antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 29183-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

GANAB Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 29183-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

glucosidase, alpha; neutral AB, Glucosidase II subunit alpha, G2AN, EC:3.2.1.207, Alpha-glucosidase 2

---

Product Information

29183-1-PBS targets GANAB in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag30417

  Product name: Recombinant human GANAB protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 350-488 aa of BC017435

  Sequence: GGTIVPRWMRVRRSSECMKDDPITLFVALSPQGTAQGELFLDDGHTFNYQTRQEFLLRRFSFSGNTLVSSSADPEGHFETPIWIERVVIIGAGKPAAVVLQTKGSPESRLSFQHDPETSVLVLRKPGINVASDWSIHLR

• Full Name: glucosidase, alpha; neutral AB
• Calculated Molecular Weight: 944aa,107 kDa; 488aa,55 kDa
• Observed Molecular Weight: 110-120 kDa
• GenBank Accession Number: BC017435
• Gene Symbol: GANAB
• Gene ID (NCBI): 23193
• RRID: AB_2918244
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q14697
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.