Home
Products
Primary Antibodies
GCSH Polyclonal antibody, PBS Only (16726-1-PBS)

Filter: AllWBIPIHCIF/ICC

WB analysis of HEK-293 using 16726-1-AP (same clone as 16726-1-PBS)
HEK-293 cells were subjected to SDS PAGE followed by western blot with 16726-1-AP (GCSH antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 16726-1-PBS in a different storage buffer formulation.
WB analysis of mouse brain using 16726-1-AP (same clone as 16726-1-PBS)
mouse brain tissue were subjected to SDS PAGE followed by western blot with 16726-1-AP (GCSH antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 16726-1-PBS in a different storage buffer formulation.
WB analysis of mouse kidney using 16726-1-AP (same clone as 16726-1-PBS)
mouse kidney tissue were subjected to SDS PAGE followed by western blot with 16726-1-AP (GCSH antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 16726-1-PBS in a different storage buffer formulation.
WB analysis of HeLa using 16726-1-AP (same clone as 16726-1-PBS)
HeLa cells were subjected to SDS PAGE followed by western blot with 16726-1-AP (GCSH antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 16726-1-PBS in a different storage buffer formulation.
WB analysis of human liver using 16726-1-AP (same clone as 16726-1-PBS)
human liver tissue were subjected to SDS PAGE followed by western blot with 16726-1-AP (GCSH antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 16726-1-PBS in a different storage buffer formulation.
IP experiment of mouse kidney using 16726-1-AP (same clone as 16726-1-PBS)
IP result of anti-GCSH (IP:16726-1-AP, 3ug; Detection:16726-1-AP 1:1000) with mouse kidney tissue lysate 4000ug. This data was developed using the same antibody clone with 16726-1-PBS in a different storage buffer formulation.
IHC staining of human ovary cancer using 16726-1-AP (same clone as 16726-1-PBS)
Immunohistochemical analysis of paraffin-embedded human ovarian cancer slide using 16726-1-AP (GCSH antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 16726-1-PBS in a different storage buffer formulation.
IHC staining of human ovary cancer using 16726-1-AP (same clone as 16726-1-PBS)
Immunohistochemical analysis of paraffin-embedded human ovarian cancer slide using 16726-1-AP (GCSH antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 16726-1-PBS in a different storage buffer formulation.
IHC staining of human kidney using 16726-1-AP (same clone as 16726-1-PBS)
Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 16726-1-AP (GCSH Antibody) at dilution of 1:200 (under 10x lens). This data was developed using the same antibody clone with 16726-1-PBS in a different storage buffer formulation.
IHC staining of human kidney using 16726-1-AP (same clone as 16726-1-PBS)
Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 16726-1-AP (GCSH Antibody) at dilution of 1:200 (under 40x lens). This data was developed using the same antibody clone with 16726-1-PBS in a different storage buffer formulation.
IHC staining of rat ovary using 16726-1-AP (same clone as 16726-1-PBS)
Immunohistochemical analysis of paraffin-embedded rat ovary slide using 16726-1-AP (GCSH Antibody) at dilution of 1:50. This data was developed using the same antibody clone with 16726-1-PBS in a different storage buffer formulation.
IHC staining of rat ovary using 16726-1-AP (same clone as 16726-1-PBS)
Immunohistochemical analysis of paraffin-embedded rat ovary slide using 16726-1-AP (GCSH Antibody) at dilution of 1:50. This data was developed using the same antibody clone with 16726-1-PBS in a different storage buffer formulation.
IHC staining of human skin using 16726-1-AP (same clone as 16726-1-PBS)
Immunohistochemical analysis of paraffin-embedded human skin using 16726-1-AP (GCSH antibody) at dilution of 1:100 (under 10x lens). This data was developed using the same antibody clone with 16726-1-PBS in a different storage buffer formulation.
IHC staining of human skin using 16726-1-AP (same clone as 16726-1-PBS)
Immunohistochemical analysis of paraffin-embedded human skin using 16726-1-AP (GCSH antibody) at dilution of 1:100 (under 40x lens). This data was developed using the same antibody clone with 16726-1-PBS in a different storage buffer formulation.
IHC staining of human liver using 16726-1-AP (same clone as 16726-1-PBS)
Immunohistochemical analysis of paraffin-embedded human liver using 16726-1-AP (GCSH antibody) at dilution of 1:100 (under 10x lens). This data was developed using the same antibody clone with 16726-1-PBS in a different storage buffer formulation.
IHC staining of human liver using 16726-1-AP (same clone as 16726-1-PBS)
Immunohistochemical analysis of paraffin-embedded human liver using 16726-1-AP (GCSH antibody) at dilution of 1:100 (under 40x lens). This data was developed using the same antibody clone with 16726-1-PBS in a different storage buffer formulation.
IHC staining of human ovary using 16726-1-AP (same clone as 16726-1-PBS)
Immunohistochemical analysis of paraffin-embedded human ovary using 16726-1-AP (GCSH antibody) at dilution of 1:100 (under 10x lens). This data was developed using the same antibody clone with 16726-1-PBS in a different storage buffer formulation.
IHC staining of human ovary using 16726-1-AP (same clone as 16726-1-PBS)
Immunohistochemical analysis of paraffin-embedded human ovary using 16726-1-AP (GCSH antibody) at dilution of 1:100 (under 40x lens). This data was developed using the same antibody clone with 16726-1-PBS in a different storage buffer formulation.
IF Staining of MCF-7 using 16726-1-AP (same clone as 16726-1-PBS)
Immunofluorescent analysis of MCF-7 cells, using GCSH antibody 16726-1-AP at 1:25 dilution and Rhodamine-labeled goat anti-rabbit IgG (red). This data was developed using the same antibody clone with 16726-1-PBS in a different storage buffer formulation.
IF Staining of HepG2 using 16726-1-AP (same clone as 16726-1-PBS)
Immunofluorescent analysis of HepG2 cells, using GCSH antibody 16726-1-AP at 1:50 dilution and Rhodamine-labeled goat anti-rabbit IgG (red). This data was developed using the same antibody clone with 16726-1-PBS in a different storage buffer formulation.

Featured Product
KD/KO Validated

GCSH Polyclonal antibody, PBS Only

Name: GCSH Polyclonal antibody, PBS Only
Brand: Proteintech
SKU: 16726-1-PBS

GCSH Polyclonal Antibody for WB, IHC, IF/ICC, IP, Indirect ELISA

Cat No. 16726-1-PBS

Review Product

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, Indirect ELISA

Synonyms

NKH, MMDS7, Glycine cleavage system H protein, mitochondrial, GCE

Formulation: PBS Only

PBS, Azide, Glycerol

Conjugate: Unconjugated

Size/Concentration:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Overview

Tested Applications
Product Information

Print datasheet

MSDS SDS

Product Information

16726-1-PBS targets GCSH in WB, IHC, IF/ICC, IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity	human, mouse, rat
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag10174 Product name: Recombinant human GCSH protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-173 aa of BC000790 Sequence: MALRVVRSVRALLCTLRAVPLPAAPCPPRPWQLGVGAVRTLRTGPALLSVRKFTEKHEWVTTENGIGTVGISNFAQEALGDVVYCSLPEVGTKLNKQDEFGALESVKAASELYSPLSGEVTEINEALAENPGLVNKSCYEDGWLIKMTLSNPSELDELMSEEAYEKYIKSIEE Predict reactive species
Full Name	glycine cleavage system protein H (aminomethyl carrier)
Calculated Molecular Weight	19 kDa
Observed Molecular Weight	15 kDa
GenBank Accession Number	BC000790
Gene Symbol	GCSH
Gene ID (NCBI)	2653
RRID	AB_2247351
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	P23434
Storage Buffer	PBS only, pH 7.3.
Storage Conditions	Store at -80°C.

Background Information

GCSH(Glycine cleavage system H protein, mitochondrial) is a component of the glycine cleavage system loosely associated with the mitochondrial inner membrane and has lipoic acid as a prosthetic group. The full-length GCSH cDNA encodes a precursor protein of 173 amino acids and a mature protein of 125 amino acids. The lipoylation of H-protein occurs in mitochondria which probably contain an activated form of lipoic acid as well as other components required for the transfer of lipoic acid to the protein(PMID:2211640). Defects in GCSH are a cause of non-ketotic hyperglycinemia (NKH).