GDF9 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• GDF9 Polyclonal antibody, PBS Only (29309-1-PBS)

• 

  WB analysis using 29309-1-AP (same clone as 29309-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 29309-1-AP (GDF9 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 29309-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 29309-1-AP (same clone as 29309-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 29309-1-AP (GDF9 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 29309-1-PBS in a different storage buffer formulation.

• 

  IP experiment of A2780 using 29309-1-AP (same clone as 29309-1-PBS)

  IP result of anti-GDF9 (IP:29309-1-AP, 4ug; Detection:29309-1-AP 1:2000) with A2780 cells lysate 760 ug. This data was developed using the same antibody clone with 29309-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse ovary using 29309-1-AP (same clone as 29309-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse ovary tissue slide using 29309-1-AP (GDF9 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 29309-1-PBS in a different storage buffer formulation.

• 

  IF Staining of SKOV-3 using 29309-1-AP (same clone as 29309-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed SKOV-3 cells using GDF9 antibody (29309-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 29309-1-PBS in a different storage buffer formulation.

GDF9 Polyclonal Antibody for WB, IHC, IF/ICC, IP, Indirect ELISA

Cat No. 29309-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, Indirect ELISA

Synonyms

GDF 9, GDF-9

---

Product Information

29309-1-PBS targets GDF9 in WB, IHC, IF/ICC, IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag29603

  Product name: Recombinant human GDF9 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 400-454 aa of BC096228

  Sequence: TMVQNIIYEKLDSSVPRPSCVPAKYSPLSVLTIEPDGSIAYKEYEDMIATKCTCR

• Full Name: growth differentiation factor 9
• Calculated Molecular Weight: 454 aa, 51 kDa
• Observed Molecular Weight: 70 kDa
• GenBank Accession Number: BC096228
• Gene Symbol: GDF9
• Gene ID (NCBI): 2661
• RRID: AB_3086112
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O60383
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

GDF9 (Growth/differentiation factor 9) belongs to the TGF-beta family. GDF9 is required for ovarian folliculogenesis. GDF9 and BMP15 are oocyte-secreted factors with a leading role in the control of ovarian function in female reproduction, modulating both the cell fate of the somatic granulosa cells and the quality and developmental competence of the egg (PMID: 29544636). GDF9 promotes cell transition from G0/G1 to S and G2/M phases, through an increase of CCND1 and CCNE1 expression, and RB1 phosphorylation (PMID: 19366876). It regulates STAR expression and cAMP-dependent progesterone release in granulosa and thecal cells. GDF9 attenuates the suppressive effects of activin A on STAR expression and progesterone production by increasing the expression of inhibin B (PMID: 21829661). It suppresses FST and FSTL3 production in granulosa-lutein cells  (PMID: 21632818, PMID: 21829661).