Home
Products
Primary Antibodies
GGCX Polyclonal antibody, PBS Only (16209-1-PBS)

Filter: AllWBIPIHC

WB analysis of MCF-7 using 16209-1-AP (same clone as 16209-1-PBS)
MCF7 cells were subjected to SDS PAGE followed by western blot with 16209-1-AP (GGCX antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 16209-1-PBS in a different storage buffer formulation.
WB analysis of HepG2 using 16209-1-AP (same clone as 16209-1-PBS)
HepG2 cells were subjected to SDS PAGE followed by western blot with 16209-1-AP (GGCX antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 16209-1-PBS in a different storage buffer formulation.
WB analysis of MCF-7 using 16209-1-AP (same clone as 16209-1-PBS)
MCF7 cells were subjected to SDS PAGE followed by western blot with 16209-1-AP (GGCX antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 16209-1-PBS in a different storage buffer formulation.
WB analysis of HepG2 using 16209-1-AP (same clone as 16209-1-PBS)
HepG2 cells were subjected to SDS PAGE followed by western blot with 16209-1-AP (GGCX antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 16209-1-PBS in a different storage buffer formulation.
WB analysis of PC-3 using 16209-1-AP (same clone as 16209-1-PBS)
PC-3 cells were subjected to SDS PAGE followed by western blot with 16209-1-AP (GGCX antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 16209-1-PBS in a different storage buffer formulation.
WB analysis of PC-3 using 16209-1-AP (same clone as 16209-1-PBS)
PC-3 cells were subjected to SDS PAGE followed by western blot with 16209-1-AP (GGCX antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 16209-1-PBS in a different storage buffer formulation.
WB analysis of mouse liver using 16209-1-AP (same clone as 16209-1-PBS)
mouse liver tissue were subjected to SDS PAGE followed by western blot with 16209-1-AP (GGCX antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 16209-1-PBS in a different storage buffer formulation.
WB analysis of HEK-293 using 16209-1-AP (same clone as 16209-1-PBS)
HEK-293 cells were subjected to SDS PAGE followed by western blot with 16209-1-AP (GGCX antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 16209-1-PBS in a different storage buffer formulation.
WB analysis of mouse liver using 16209-1-AP (same clone as 16209-1-PBS)
mouse liver tissue were subjected to SDS PAGE followed by western blot with 16209-1-AP (GGCX antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 16209-1-PBS in a different storage buffer formulation.
WB analysis of MCF-7 using 16209-1-AP (same clone as 16209-1-PBS)
MCF7 cells were subjected to SDS PAGE followed by western blot with 16209-1-AP (GGCX antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 16209-1-PBS in a different storage buffer formulation.
WB analysis of L02 using 16209-1-AP (same clone as 16209-1-PBS)
L02 cells were subjected to SDS PAGE followed by western blot with 16209-1-AP (GGCX antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 16209-1-PBS in a different storage buffer formulation.
IP experiment of mouse liver using 16209-1-AP (same clone as 16209-1-PBS)
IP result of anti-GGCX (IP:16209-1-AP, 4ug; Detection:16209-1-AP 1:2000) with mouse liver tissue lysate 4000ug. This data was developed using the same antibody clone with 16209-1-PBS in a different storage buffer formulation.
IHC staining of human liver using 16209-1-AP (same clone as 16209-1-PBS)
Immunohistochemical analysis of paraffin-embedded human liver using 16209-1-AP (GGCX antibody) at dilution of 1:100 (under 10x lens). This data was developed using the same antibody clone with 16209-1-PBS in a different storage buffer formulation.
IHC staining of human liver using 16209-1-AP (same clone as 16209-1-PBS)
Immunohistochemical analysis of paraffin-embedded human liver using 16209-1-AP (GGCX antibody) at dilution of 1:100 (under 40x lens). This data was developed using the same antibody clone with 16209-1-PBS in a different storage buffer formulation.
IHC staining of human liver using 16209-1-AP (same clone as 16209-1-PBS)
Immunohistochemical analysis of paraffin-embedded human liver using 16209-1-AP (GGCX antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 16209-1-PBS in a different storage buffer formulation.
IHC staining of human liver using 16209-1-AP (same clone as 16209-1-PBS)
Immunohistochemical analysis of paraffin-embedded human liver using 16209-1-AP (GGCX antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 16209-1-PBS in a different storage buffer formulation.
IHC staining of human brain using 16209-1-AP (same clone as 16209-1-PBS)
Immunohistochemical analysis of paraffin-embedded human brain using 16209-1-AP (GGCX antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 16209-1-PBS in a different storage buffer formulation.
IHC staining of human brain using 16209-1-AP (same clone as 16209-1-PBS)
Immunohistochemical analysis of paraffin-embedded human brain using 16209-1-AP (GGCX antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 16209-1-PBS in a different storage buffer formulation.

Featured Product
KD/KO Validated

GGCX Polyclonal antibody, PBS Only

Name: GGCX Polyclonal antibody, PBS Only
Brand: Proteintech
SKU: 16209-1-PBS

GGCX Polyclonal Antibody for WB, IHC, IP, Indirect ELISA

Cat No. 16209-1-PBS

Review Product

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IP, Indirect ELISA

Synonyms

Formulation: PBS Only

PBS, Azide, Glycerol

Conjugate: Unconjugated

Size/Concentration:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Overview

Tested Applications
Product Information

Print datasheet

MSDS SDS

Product Information

16209-1-PBS targets GGCX in WB, IHC, IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity	human, mouse, rat
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag9185 Product name: Recombinant human GGCX protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 383-758 aa of BC013979 Sequence: LTQGYNNWTNGLYGYSWDMMVHSRSHQHVKITYRDGRTGELGYLNPGVFTQSRRWKDHADMLKQYATCLSRLLPKYNVTEPQIYFDIWVSINDRFQQRIFDPRVDIVQAAWSPFQRTSWVQPLLMDLSPWRAKLQEIKSSLDNHTEVVFIADFPGLHLENFVSEDLGNTSIQLLQGEVTVELVAEQKNQTLREGEKMQLPAGEYHKVYTTSPSPSCYMYVYVNTTELALEQDLAYLQELKEKVENGSETGPLPPELQPLLEGEVKGGPEPTPLVQTFLRRQQRLQEIERRRNTPFHERFFRFLLRKLYVFRRSFLMTCISLRNLILGRPSLEQLAQEVTYANLRPFEAVGELNPSNTDSSHSNPPESNPDPVHSEF Predict reactive species
Full Name	gamma-glutamyl carboxylase
Calculated Molecular Weight	758 aa, 88 kDa
Observed Molecular Weight	88 kDa
GenBank Accession Number	BC013979
Gene Symbol	GGCX
Gene ID (NCBI)	2677
RRID	AB_2110874
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	P38435
Storage Buffer	PBS only, pH 7.3.
Storage Conditions	Store at -80°C.

Background Information

GGCX(Gamma-glutamyl carboxylase) is also named as GC and belongs to the vitamin K-dependent gamma-carboxylase family. This 94 kDa (including all modifications, such as the five N-linked glycosylations), is a 5-pass transmembrane protein and a key regulator of blood coagulation(PMID:20518534). It mediates the vitamin K-dependent carboxylation of glutamate residues to calcium-binding gamma-carboxyglutamate (Gla) residues with the concomitant conversion of the reduced hydroquinone form of vitamin K to vitamin K epoxide. Defects in GGCX are a cause of combined deficiency of vitamin K-dependent clotting factors type 1 (VKCFD1) and pseudoxanthoma elasticum-like disorder with multiple coagulation factor deficiency (PXEL-MCFD)(PMID:9845520;17110937).